KEGG   Methanocaldococcus sp. FS406-22: MFS40622_0018Help
Entry
MFS40622_0018     CDS       T01175                                 

Definition
(RefSeq) succinyl-CoA synthetase subunit beta
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mfs  Methanocaldococcus sp. FS406-22
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mfs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MFS40622_0018
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MFS40622_0018
   00640 Propanoate metabolism
    MFS40622_0018
   00660 C5-Branched dibasic acid metabolism
    MFS40622_0018
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MFS40622_0018
Enzymes [BR:mfs01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     MFS40622_0018
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
15515..16609
Genome map
AA seq 364 aa AA seqDB search
MKLHEYEAKNIFKKYGIPVPNSFLVSKGDDLNSIEIDREVVLKAQVLVGGRGKAGGILFA
SNKEEFIKKAEELFNKEVKGEKVEKILVEEKLPIEKEYYVSIIIDRDAKKPLIIFSTEGG
VDIEEVAEKNPEKIIKYHVDVKKPFLPYVARWIVKEAKLPSNEIGKVADVIYKLYKIFKE
LDATMVEINPLVITEDGNVYAADAVLHLDDDAAFRHNYEEFEEYKNKEKLPFAYVELDGD
VAVIGNGAGLTLASMDVINNLGRKPACFLDIGGGADAETVKLALRKVLENKNVKGIFINI
LGGITRCDEVAKGIVEVLKEHPNIKFAVRMMGTNEDIGRKILEEHGIPYETSMEEAGRKL
IEQL
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaaactacatgaatatgaagctaaaaacatatttaaaaagtatggcattcctgtccca
aatagttttttagtatctaagggagacgatttaaacagcatagagattgatagggaggtt
gttttaaaagctcaggttttagttggtgggagaggaaaagcaggaggaattttattcgca
tcaaacaaagaagaatttataaagaaagcagaagagttgtttaataaagaagttaaagga
gagaaagttgagaaaattttagttgaagagaaattgccaatagaaaaggaatattatgta
tcaattattatcgatagagatgctaaaaaaccattaattattttctcaactgaaggaggg
gtagatattgaagaagtagctgaaaagaatccagaaaagattataaagtatcacgtagat
gttaagaaaccatttttaccttacgttgcaagatggatagttaaagaagctaagttacca
agtaatgagattggaaaagttgctgatgttatttataagttatataaaatcttcaaagag
ttggatgccacaatggtagaaatcaacccattggttataactgaagatggtaatgtctac
gccgctgatgctgttcttcacttagatgatgatgctgcatttagacacaactatgaagaa
tttgaggaatataaaaataaagaaaaattgccatttgcctatgttgagttagatggggat
gtggctgttataggtaatggggcaggtttaacattggcaagtatggatgtaattaacaac
ctcggcagaaagccagcttgcttcttagatattggaggaggggctgatgctgaaacagta
aaattagctttaagaaaagttttagagaataaaaatgttaaaggaatatttatcaatatc
ttaggaggaattacaaggtgtgatgaagtagccaaaggaattgttgaggttttgaaagaa
cacccaaatataaagtttgccgtcagaatgatgggaactaatgaggatataggtagaaaa
attttggaagaacatggaattccttatgagacatcaatggaggaggctggaagaaagttg
attgaacagttataa

DBGET integrated database retrieval system