KEGG   Methanocaldococcus sp. FS406-22: MFS40622_0018Help
Entry
MFS40622_0018     CDS       T01175                                 

Definition
succinyl-CoA synthetase subunit beta
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mfs  Methanocaldococcus sp. FS406-22
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mfs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MFS40622_0018
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MFS40622_0018
   00640 Propanoate metabolism
    MFS40622_0018
   00660 C5-Branched dibasic acid metabolism
    MFS40622_0018
Enzymes [BR:mfs01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     MFS40622_0018
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
15515..16609
Genome map
AA seq 364 aa AA seqDB search
MKLHEYEAKNIFKKYGIPVPNSFLVSKGDDLNSIEIDREVVLKAQVLVGGRGKAGGILFA
SNKEEFIKKAEELFNKEVKGEKVEKILVEEKLPIEKEYYVSIIIDRDAKKPLIIFSTEGG
VDIEEVAEKNPEKIIKYHVDVKKPFLPYVARWIVKEAKLPSNEIGKVADVIYKLYKIFKE
LDATMVEINPLVITEDGNVYAADAVLHLDDDAAFRHNYEEFEEYKNKEKLPFAYVELDGD
VAVIGNGAGLTLASMDVINNLGRKPACFLDIGGGADAETVKLALRKVLENKNVKGIFINI
LGGITRCDEVAKGIVEVLKEHPNIKFAVRMMGTNEDIGRKILEEHGIPYETSMEEAGRKL
IEQL
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaaactacatgaatatgaagctaaaaacatatttaaaaagtatggcattcctgtccca
aatagttttttagtatctaagggagacgatttaaacagcatagagattgatagggaggtt
gttttaaaagctcaggttttagttggtgggagaggaaaagcaggaggaattttattcgca
tcaaacaaagaagaatttataaagaaagcagaagagttgtttaataaagaagttaaagga
gagaaagttgagaaaattttagttgaagagaaattgccaatagaaaaggaatattatgta
tcaattattatcgatagagatgctaaaaaaccattaattattttctcaactgaaggaggg
gtagatattgaagaagtagctgaaaagaatccagaaaagattataaagtatcacgtagat
gttaagaaaccatttttaccttacgttgcaagatggatagttaaagaagctaagttacca
agtaatgagattggaaaagttgctgatgttatttataagttatataaaatcttcaaagag
ttggatgccacaatggtagaaatcaacccattggttataactgaagatggtaatgtctac
gccgctgatgctgttcttcacttagatgatgatgctgcatttagacacaactatgaagaa
tttgaggaatataaaaataaagaaaaattgccatttgcctatgttgagttagatggggat
gtggctgttataggtaatggggcaggtttaacattggcaagtatggatgtaattaacaac
ctcggcagaaagccagcttgcttcttagatattggaggaggggctgatgctgaaacagta
aaattagctttaagaaaagttttagagaataaaaatgttaaaggaatatttatcaatatc
ttaggaggaattacaaggtgtgatgaagtagccaaaggaattgttgaggttttgaaagaa
cacccaaatataaagtttgccgtcagaatgatgggaactaatgaggatataggtagaaaa
attttggaagaacatggaattccttatgagacatcaatggaggaggctggaagaaagttg
attgaacagttataa

  All links  
No link information was found.   
DBGET integrated database retrieval system