KEGG   Methanocaldococcus sp. FS406-22: MFS40622_0048Help
Entry
MFS40622_0048     CDS       T01175                                 

Definition
asparagine synthase (glutamine-hydrolyzing)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
mfs  Methanocaldococcus sp. FS406-22
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mfs00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MFS40622_0048
Enzymes [BR:mfs01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     MFS40622_0048
Peptidases [BR:mfs01002]
 Cysteine Peptidases
  Family C44
   MFS40622_0048
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
39758..41281
Genome map
AA seq 507 aa AA seqDB search
MCSISGIIVKESQIPAKYAIDMMKILKHRGRDNSGLLLDDEVIYFNNFEDVEDLEEEEMI
GNLNLAHNRLAIVGRYGVQPIPNEDEDIWLVCNGEIYNYIELREYLKENHEFRTDSDNEV
IIHLYEDEQLEELDGDYAFAIYDKSKDIVLLGRDVFGVKPLFYVDTPNYFAFASERKALW
HLLINIDGYERDLDVLNSKIKTLKPNSQLIYYLDDNKFDIIENFKKMELNYMKERSYEEA
KEYLDRALKNAVLKRVRGLDRVGIICSGGVDSSLIAKLSSLYCEVILYAVGTENSEDLIY
AERLAKDLNLKIRKKIISEEEYERYVFKVAKAIDEVDLMKIGVGIPIYVASEMANEDGLK
VVLSGQGADELFGGYARHERIYREKGEEELKKELLKDVYNLYKVNLERDDHCTMANGVEL
RVPFLDEEVVEIALSIPIEYKMSELRKRILRDVASQYLPDYIAYRPKKAAQYGSGGEKMI
YKVAKKYGFSKKKINEFLDMLKRKIVE
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgtgctctataagtggaataattgttaaagaaagccaaatacctgcaaaatatgcaata
gatatgatgaaaatcttaaagcacagaggaagagataactctggattgttgttagatgat
gaggttatatacttcaacaactttgaagatgttgaagatttagaggaggaggagatgatt
ggaaatctaaacttagcacataacagattggcaatagttggaaggtatggggttcagcca
atacctaacgaggatgaagatatttggctggtttgtaatggagaaatctacaattatata
gagttgagagagtatctaaaagaaaatcatgaatttaggacagacagcgataatgaggtt
ataatccacttatatgaagatgagcagttggaagaattggatggggattatgcctttgcc
atttatgataaatcaaaggatattgtgttattgggaagggatgtatttggagttaagccg
ttgttttatgtagatacgcctaattattttgcatttgcttcagagagaaaagcattgtgg
catctgcttataaatattgatggctatgagagagatttagatgtcttaaatagcaaaatc
aaaacattaaagccaaattcacagttaatttattatttggatgataataagttcgatatt
attgagaattttaaaaaaatggaactaaattacatgaaagagaggagttatgaagaggct
aaagaatatttagatagggctttgaagaatgcagttttaaagagggttagaggtttggat
agggtagggattatctgctctggaggagttgatagctcattgattgctaaattatcctct
ctatactgtgaagttatcttatatgctgttggaactgaaaatagtgaggatttaatttat
gctgaaagattggctaaggatttgaatttaaagataagaaagaagattatttcagaagag
gagtatgaaaggtatgtgtttaaggtggctaaggcaatagatgaagttgatttaatgaag
ataggggtggggattcctatctatgtggcatcagagatggctaatgaagatggattaaag
gttgttctatctgggcaaggggctgatgagttattcggtggctatgcaaggcatgagagg
atttatagggagaaaggagaggaagagctaaaaaaagagctattgaaggatgtttataat
ctatacaaggtaaatttagagagggatgaccactgcacaatggctaatggtgttgagttg
agagttcctttcttagatgaggaggttgttgagattgccttatcaattcctattgaatat
aaaatgtctgaacttaggaaaaggattttgagggatgttgcctctcaatatttgccagat
tatattgcttataggccaaaaaaagccgctcaatatggaagtggtggggagaagatgatt
tataaggttgctaaaaaatatggattttcaaagaagaaaattaatgagtttttggatatg
ttgaagagaaagattgttgagtag

DBGET integrated database retrieval system