KEGG   Methanocaldococcus sp. FS406-22: MFS40622_0100Help
Entry
MFS40622_0100     CDS       T01175                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
mfs  Methanocaldococcus sp. FS406-22
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
83430..84077
Genome map
AA seq 215 aa AA seqDB search
MNLEEQKKAVIERLIREGYIKSKRVIDALLKVPREEFVPEHLKEYAYVDKPLEIGYGQTI
SAIHMVGMMSELLDLKPGMKVLEIGTGCGYHAAVTAEIVGEDGLVVSIERIPELAEKAER
TLRKLGYDNVIVIVGDGTLGYEPLAPYDRIYTTAAGPKIPEPLIKQLKDGGKLLMPIGRY
LQKLVLAEKRGNEIIVKDCGPVAFVPLIGREGFYG
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgaacttagaagagcaaaagaaagcagtaattgaaagattaattagggaggggtatata
aaaagtaaaagagtgattgatgccctattaaaagttccaagggaagagtttgttcctgaa
catttaaaggaatatgcctatgttgataaaccattagagattggttatgggcagacaatt
tcagccatacatatggttggaatgatgagcgagcttttagatttaaagccaggtatgaaa
gttttggaaattggaactggttgtggttaccatgcggcagtaactgctgagattgtgggg
gaggatggtttagttgttagcattgaaagaattccagaattggctgaaaaagcagagaga
actttaagaaaattgggatatgataatgttattgtgatagtgggggatggaactttggga
tatgagccattagccccttatgatagaatatatacaactgcagcaggtccaaaaattcca
gaaccattaataaagcaattaaaagatgggggaaaactattaatgcctattggtagatac
ttacaaaaattagttttagctgaaaagagaggaaatgaaataatagtaaaggactgcgga
cctgtagcatttgtccctttgattggtagagaagggttttatggataa

DBGET integrated database retrieval system