KEGG   Methanocaldococcus sp. FS406-22: MFS40622_0189Help
Entry
MFS40622_0189     CDS       T01175                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
mfs  Methanocaldococcus sp. FS406-22
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:mfs00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    MFS40622_0189
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MFS40622_0189
Enzymes [BR:mfs01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     MFS40622_0189
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
177958..178875
Genome map
AA seq 305 aa AA seqDB search
MRHLISMKDIGKEEILEILEEAKRMEEFLNTKRPLKLLEGKILATVFYEPSTRTRLSFET
AMKRLGGDVITMTDLKSSSVAKGESLIDTIRVISGYADIIVLRHPSEGAARLASEYSQVP
IINAGDGSNQHPTQTLLDLYTIMREIGRIDGIKIAFVGDLKYGRTVHSLVYALSLFDNVE
MYFISPKELKMPRDIIEDLKAKNIKFYEKESLDDLDEDVDVLYVTRIQKERFPDPNEYEK
VKGSYKIKREYVEGKKFIIMHPLPRVDEIDYDVDDLPQAKYFKQSFYGIPVRMAILKKLI
EDNER
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgaggcatctaatttcaatgaaagatattggaaaagaggaaattttagagattttagaa
gaggctaagaggatggaggagtttttaaatacaaagaggcctttgaagttattagaaggg
aagatattagcaactgttttttatgagccatcaacaaggacacgattgagttttgaaaca
gccatgaaaagattgggtggggatgttataacaatgactgatttaaaaagctcttctgtt
gcaaagggagagagtttgatagacacgattagagttataagtggctatgccgatataatt
gttctaagacatccatctgaaggagcggcaagattggcttctgaatattctcaagttcca
attataaacgctggagatggaagtaatcaacatcctacacaaactcttttggatttatac
acaataatgagagagattggcagaatagacgggataaagatagcgtttgttggagatttg
aagtatggaagaactgttcattctttggtttatgccctctctttatttgataacgttgag
atgtattttatatctccgaaagagttgaagatgccaagagatataattgaagatttaaaa
gctaaaaacataaaattctatgaaaaggaaagcttagatgatttagatgaggatgttgat
gtcttatatgtaacaagaattcaaaaggagagatttccagaccctaatgagtatgaaaag
gttaaaggtagctataagataaagagagagtatgttgaaggaaagaaatttataattatg
catccactaccaagggttgatgagattgactatgacgttgatgatttgcctcaagcaaag
tatttcaagcagagtttttatggaattcctgtaagaatggctattttaaagaagttaatt
gaggataatgaaaggtga

DBGET integrated database retrieval system