KEGG   Methanocaldococcus sp. FS406-22: MFS40622_0194Help
Entry
MFS40622_0194     CDS       T01175                                 

Definition
(GenBank) Fructose-bisphosphate aldolase
  KO
K16305  fructose-bisphosphate aldolase / 6-deoxy-5-ketofructose 1-phosphate synthase [EC:4.1.2.13 2.2.1.11]
Organism
mfs  Methanocaldococcus sp. FS406-22
Pathway
mfs00010  Glycolysis / Gluconeogenesis
mfs00030  Pentose phosphate pathway
mfs00051  Fructose and mannose metabolism
mfs00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mfs00680  Methane metabolism
mfs01100  Metabolic pathways
mfs01110  Biosynthesis of secondary metabolites
mfs01120  Microbial metabolism in diverse environments
mfs01130  Biosynthesis of antibiotics
mfs01200  Carbon metabolism
mfs01230  Biosynthesis of amino acids
Module
mfs_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mfs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MFS40622_0194
   00030 Pentose phosphate pathway
    MFS40622_0194
   00051 Fructose and mannose metabolism
    MFS40622_0194
  Energy metabolism
   00680 Methane metabolism
    MFS40622_0194
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MFS40622_0194
Enzymes [BR:mfs01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.11  6-deoxy-5-ketofructose 1-phosphate synthase
     MFS40622_0194
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     MFS40622_0194
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DeoC
Motif
Other DBs
NCBI-ProteinID: ADC68891
JGI: MFS40622_0194
UniProt: D3S781
Position
complement(181220..182140)
Genome map
AA seq 306 aa AA seqDB search
MVKRLKKKDVKVPLTVPEDMKEEYIKNYLELTKRTGNVMIFAGDQRIEHLNDDFFGEGIA
KEDASPEHLFNIASKGKICGFATQLGLIARYGMDYKKVPYIVKINSKTHLVKTRDPISRA
LVTVKDVVELKENSGLNILGVGYTIYPGSEYEHIMFEEASRVILEAHKHGLIAIIWSYPR
GKNVKDEKDPHIIAGAAGVAACLGADFVKVNYPKCDNPAERFKEAVLAAGRTGVLCAGGK
SIEPEKFLKQIWEQINISGARGNATGRNIHQKPLDDAVRMCNAIYAITIEGKSLEEALKI
YYGDRK
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaaaggcttaaaaagaaagatgtgaaagtgccattaactgttccagaggatatg
aaagaggagtatatcaaaaactacttagagctaacaaagagaactggaaatgttatgata
tttgctggagaccagaggattgagcatttaaatgatgatttctttggggaggggattgct
aaagaggacgcatctccagagcatctatttaatatagcaagtaaagggaaaatctgcgga
tttgctacacaactcggtttaatagcaaggtatggaatggattataaaaaagttccttat
attgtgaagattaattcaaaaactcatctggttaaaacaagagaccctataagtagggct
ttagttacagttaaagatgttgttgagcttaaagaaaactctggattgaacatattgggt
gttggttataccatataccccggaagtgagtatgagcatatcatgtttgaggaggcttcg
agggttattttagaggctcataaacatggcttaattgcaataatctggagctatccaaga
ggtaaaaatgttaaagatgaaaaagaccctcacataatagctggagctgctggagttgct
gcatgcttaggagcagattttgttaaggttaattacccaaagtgtgataacccagcagag
agatttaaagaggcggttttagccgctggaagaactggagttttatgtgctggaggaaag
agcatagaaccagagaaatttttaaaacagatttgggagcaaattaatatcagtggagca
agaggaaatgcaactggaagaaatatccaccaaaaaccattagatgatgctgtaaggatg
tgcaatgcaatatatgcaataaccattgaaggaaaaagcttggaagaggctttaaagata
tattatggagatagaaaataa

DBGET integrated database retrieval system