KEGG   Methanocaldococcus sp. FS406-22: MFS40622_0194Help
Entry
MFS40622_0194     CDS       T01175                                 

Definition
Fructose-bisphosphate aldolase (EC:4.1.2.13)
Orthology
K16305  
fructose-bisphosphate aldolase / 6-deoxy-5-ketofructose 1-phosphate synthase [EC:4.1.2.13 2.2.1.11]
Organism
mfs  Methanocaldococcus sp. FS406-22
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mfs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MFS40622_0194
   01230 Biosynthesis of amino acids
    MFS40622_0194
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MFS40622_0194
   00030 Pentose phosphate pathway
    MFS40622_0194
   00051 Fructose and mannose metabolism
    MFS40622_0194
  Energy metabolism
   00680 Methane metabolism
    MFS40622_0194
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MFS40622_0194
Enzymes [BR:mfs01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.11  6-deoxy-5-ketofructose 1-phosphate synthase
     MFS40622_0194
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     MFS40622_0194
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(181220..182140)
Genome map
AA seq 306 aa AA seqDB search
MVKRLKKKDVKVPLTVPEDMKEEYIKNYLELTKRTGNVMIFAGDQRIEHLNDDFFGEGIA
KEDASPEHLFNIASKGKICGFATQLGLIARYGMDYKKVPYIVKINSKTHLVKTRDPISRA
LVTVKDVVELKENSGLNILGVGYTIYPGSEYEHIMFEEASRVILEAHKHGLIAIIWSYPR
GKNVKDEKDPHIIAGAAGVAACLGADFVKVNYPKCDNPAERFKEAVLAAGRTGVLCAGGK
SIEPEKFLKQIWEQINISGARGNATGRNIHQKPLDDAVRMCNAIYAITIEGKSLEEALKI
YYGDRK
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaaaggcttaaaaagaaagatgtgaaagtgccattaactgttccagaggatatg
aaagaggagtatatcaaaaactacttagagctaacaaagagaactggaaatgttatgata
tttgctggagaccagaggattgagcatttaaatgatgatttctttggggaggggattgct
aaagaggacgcatctccagagcatctatttaatatagcaagtaaagggaaaatctgcgga
tttgctacacaactcggtttaatagcaaggtatggaatggattataaaaaagttccttat
attgtgaagattaattcaaaaactcatctggttaaaacaagagaccctataagtagggct
ttagttacagttaaagatgttgttgagcttaaagaaaactctggattgaacatattgggt
gttggttataccatataccccggaagtgagtatgagcatatcatgtttgaggaggcttcg
agggttattttagaggctcataaacatggcttaattgcaataatctggagctatccaaga
ggtaaaaatgttaaagatgaaaaagaccctcacataatagctggagctgctggagttgct
gcatgcttaggagcagattttgttaaggttaattacccaaagtgtgataacccagcagag
agatttaaagaggcggttttagccgctggaagaactggagttttatgtgctggaggaaag
agcatagaaccagagaaatttttaaaacagatttgggagcaaattaatatcagtggagca
agaggaaatgcaactggaagaaatatccaccaaaaaccattagatgatgctgtaaggatg
tgcaatgcaatatatgcaataaccattgaaggaaaaagcttggaagaggctttaaagata
tattatggagatagaaaataa

DBGET integrated database retrieval system