KEGG   Methanocaldococcus sp. FS406-22: MFS40622_0230Help
Entry
MFS40622_0230     CDS       T01175                                 

Definition
Coenzyme F420 hydrogenase (EC:1.12.98.1)
Orthology
K00441  
coenzyme F420 hydrogenase subunit beta [EC:1.12.98.1]
Organism
mfs  Methanocaldococcus sp. FS406-22
Pathway
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mfs00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    MFS40622_0230
Enzymes [BR:mfs01000]
 1. Oxidoreductases
  1.12  Acting on hydrogen as donor
   1.12.98  With other, known, acceptors
    1.12.98.1  coenzyme F420 hydrogenase
     MFS40622_0230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(218676..219749)
Genome map
AA seq 357 aa AA seqDB search
MKSYKNLKEEVWDTNRCSGCGACVAVCPVNNLYFREESPVKFECDECSCIIVPADIVEHP
ISAEFCKTVVYDVPCGACYDACPRIKKSAVPKPKGLGNILKAVRAKASIEIKNAQNGGVV
TAILANAFDEGLIDGAIVMIDDKWTLEPESYLALSKEDVLKSAGSKYLWKGPILKALKTA
VMEKKLRKLAVVGTPCVINAIYQILSSDNDLLKPFREAIRLKIALFCFETYDYSKMIKKL
SEDGIEPWEVKKMDIEASKLKITLINGNTVEYKLKDVEFAMRNGCKVCGDFTGLTSDISV
GNVGTEKGYSTVLIRNKWGEGFFKRAVYNGYITYDENVDLDAVKKLAELKRKRVKKD
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcttacaagaatctaaaagaggaagtttgggatacaaatagatgtagtggttgt
ggagcttgtgttgcagtttgtccagtaaacaacctatactttagagaggaaagtccggta
aagtttgagtgcgatgaatgctcttgtattatagtcccagcagatatcgtggagcatcca
atctcagctgagttttgtaagacagtagtttatgatgtcccttgcggagcttgctatgat
gcctgtccaaggataaaaaaatctgctgttcctaaaccaaagggattagggaatatatta
aaagctgttagagctaaggcatcaatagagataaagaatgcccaaaatggtggggttgta
acagctatattggcaaatgcatttgatgaagggttgatagatggggctattgtaatgatt
gatgataaatggactttagagccagaatcttatttggcattatcaaaagaggatgtttta
aaatcagctggtagcaaatacttatggaaagggcctatattaaaggctttaaaaactgct
gttatggagaaaaagctaagaaaattagctgttgttggaactccatgtgttataaatgcc
atatatcagatattatcatcagataacgacctattaaaaccatttagagaggcaataaga
ttaaaaattgccctgttctgttttgaaacctatgattacagcaagatgattaaaaaatta
agtgaggatggtatagaaccatgggaagttaaaaagatggatattgaggctagtaagtta
aagataaccctaattaatggaaacactgtggaatataagcttaaggatgttgaatttgca
atgagaaatggttgtaaggtttgtggtgatttcactggcttaacgtcagatatttcagtt
ggtaacgtagggactgaaaagggctattcaactgtcttaataagaaacaagtggggagaa
ggattctttaagagggctgtttataatggttatataacctatgatgagaacgttgattta
gatgctgttaaaaagcttgctgaattgaaaagaaagagagttaagaaggactaa

DBGET integrated database retrieval system