KEGG   Methanocaldococcus sp. FS406-22: MFS40622_0323Help
Entry
MFS40622_0323     CDS       T01175                                 

Definition
Cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mfs  Methanocaldococcus sp. FS406-22
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mfs00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MFS40622_0323
Enzymes [BR:mfs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     MFS40622_0323
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
311015..312067
Genome map
AA seq 350 aa AA seqDB search
MSVVEYLKKLSKLHGISGREDSVREFMKKELEKYCDSVEIDNFGNLIAKRGNSGKKIMIA
AHMDEIGLMVKYIDDNGFLKFTKIGGIYDPTILNQKVVVHGSKGDLIGVLGSKPPHRMKE
EEKTKIIKYEDMFIDIGAESREEAIEMGVNIGTWVSFLSEVYELGKYRLTGKAFDDRVGC
AVLLEIMKRLSEEDIDCQVYAVGTVQEEVGLKGARVSAFKINPDVAIALDVTIAGDHPGI
KKEDAPVDLGKGPVVGIVDASGRGLIAHPKVLEMIKAVSEKYKINVQWEVGEGGTTDATA
IHLTREGIPTGVISVPARYIHTPVEVIDKRDLEKTVELVYNCIKEVNGFF
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgagtgttgttgaatacttaaaaaaactctcaaaactacatggaatatctgggagagag
gatagtgttagagagtttatgaaaaaagagttggaaaaatattgtgattctgtagagatt
gataattttggaaatttaattgcaaaaagaggaaatagtggaaagaaaattatgatagct
gcccatatggatgagattggtttgatggttaaatatatagatgacaatggcttcttaaaa
ttcacaaaaattgggggaatttatgatccaacaatattaaaccaaaaggttgtagttcat
gggagcaaaggggatttaattggtgttcttggttcaaaaccaccgcacagaatgaaagaa
gaggaaaaaaccaaaataatcaaatatgaagatatgtttatagatattggagctgagagt
agagaagaagctatagagatgggagttaatataggaacatgggtttctttcttaagtgag
gtttatgagttagggaagtatagattaactggaaaggcatttgatgatagggttggatgt
gctgttctcttagaaattatgaagaggttatctgaagaggatatcgattgccaagtttat
gcagtgggaactgttcaagaagaagttggattaaaaggggcaagagtttctgcctttaaa
ataaatccagatgttgctattgcgttggatgtaactattgctggagaccatccaggaatt
aaaaaagaagacgctccagttgatttaggtaaagggcctgtagttgggatagtagatgca
tctggtagaggactaatagctcacccaaaagttttagagatgattaaagctgtttctgaa
aagtataaaataaatgtccagtgggaagttggagaaggggggacaactgatgcaacagct
atccatttaacaagagaaggaattcctactggtgttatttcagtcccagcaagatacata
cacacaccagtagaagttatagataaaagagatttggaaaagactgttgaattagtttat
aattgtataaaagaggttaatggtttcttctaa

DBGET integrated database retrieval system