KEGG   Methanocaldococcus sp. FS406-22: MFS40622_0323Help
Entry
MFS40622_0323     CDS       T01175                                 

Definition
(GenBank) Cellulase
Organism
mfs  Methanocaldococcus sp. FS406-22
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
311015..312067
Genome map
AA seq 350 aa AA seqDB search
MSVVEYLKKLSKLHGISGREDSVREFMKKELEKYCDSVEIDNFGNLIAKRGNSGKKIMIA
AHMDEIGLMVKYIDDNGFLKFTKIGGIYDPTILNQKVVVHGSKGDLIGVLGSKPPHRMKE
EEKTKIIKYEDMFIDIGAESREEAIEMGVNIGTWVSFLSEVYELGKYRLTGKAFDDRVGC
AVLLEIMKRLSEEDIDCQVYAVGTVQEEVGLKGARVSAFKINPDVAIALDVTIAGDHPGI
KKEDAPVDLGKGPVVGIVDASGRGLIAHPKVLEMIKAVSEKYKINVQWEVGEGGTTDATA
IHLTREGIPTGVISVPARYIHTPVEVIDKRDLEKTVELVYNCIKEVNGFF
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgagtgttgttgaatacttaaaaaaactctcaaaactacatggaatatctgggagagag
gatagtgttagagagtttatgaaaaaagagttggaaaaatattgtgattctgtagagatt
gataattttggaaatttaattgcaaaaagaggaaatagtggaaagaaaattatgatagct
gcccatatggatgagattggtttgatggttaaatatatagatgacaatggcttcttaaaa
ttcacaaaaattgggggaatttatgatccaacaatattaaaccaaaaggttgtagttcat
gggagcaaaggggatttaattggtgttcttggttcaaaaccaccgcacagaatgaaagaa
gaggaaaaaaccaaaataatcaaatatgaagatatgtttatagatattggagctgagagt
agagaagaagctatagagatgggagttaatataggaacatgggtttctttcttaagtgag
gtttatgagttagggaagtatagattaactggaaaggcatttgatgatagggttggatgt
gctgttctcttagaaattatgaagaggttatctgaagaggatatcgattgccaagtttat
gcagtgggaactgttcaagaagaagttggattaaaaggggcaagagtttctgcctttaaa
ataaatccagatgttgctattgcgttggatgtaactattgctggagaccatccaggaatt
aaaaaagaagacgctccagttgatttaggtaaagggcctgtagttgggatagtagatgca
tctggtagaggactaatagctcacccaaaagttttagagatgattaaagctgtttctgaa
aagtataaaataaatgtccagtgggaagttggagaaggggggacaactgatgcaacagct
atccatttaacaagagaaggaattcctactggtgttatttcagtcccagcaagatacata
cacacaccagtagaagttatagataaaagagatttggaaaagactgttgaattagtttat
aattgtataaaagaggttaatggtttcttctaa

DBGET integrated database retrieval system