KEGG   Methanocaldococcus sp. FS406-22: MFS40622_0412Help
Entry
MFS40622_0412     CDS       T01175                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mfs  Methanocaldococcus sp. FS406-22
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mfs00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MFS40622_0412
   00052 Galactose metabolism
    MFS40622_0412
   00500 Starch and sucrose metabolism
    MFS40622_0412
   00520 Amino sugar and nucleotide sugar metabolism
    MFS40622_0412
Enzymes [BR:mfs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MFS40622_0412
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
402466..403320
Genome map
AA seq 284 aa AA seqDB search
MIKKAVIPVAGFGTRLLPITKAQPKEMLPVVNKPIVQYVVEDLVEAGVKDILFVTGKGKQ
AIENHFDVNYELECKLEKSGKYELLKIIKEIDNLGNIFYVRQKEQKGLGDAILYGEEFVG
EEYFIAMVGDTIYSKNIVKDLIKAHEKYGCSVIALERVPKEDVYKYGVIDGEKIEEGIYR
IKNMVEKPKVEEAPSNLIITGAYLLSPKIFEKIRETPPGRGGEIQITDAMNLLLKEEEII
GVEINCKRYDIGDVLGWLKANVEIGAEKFPEFREFLKEFVKNLL
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgataaagaaggcagtaattccagtagctggttttgggactcgactgttgccaataacg
aaagcacaaccaaaagaaatgctcccagttgtgaataagccaatagttcagtatgttgtt
gaggatttagtagaagcaggagtaaaagatattttatttgtaactgggaagggtaagcag
gcgatagaaaaccactttgacgtaaactatgagttagaatgcaaattagaaaaatctgga
aaatatgaacttttgaaaatcattaaagagatagacaacttaggaaatatattttatgta
aggcagaaagagcagaaaggtttaggagatgctattttatacggggaggagtttgttggg
gaagaatactttatagcaatggttggagatacaatttactctaaaaatattgtaaaggac
ttaataaaagcccatgaaaagtatggttgttcagttatcgccttagagagggttccaaaa
gaagacgtttataagtatggagtaattgatggagaaaagatagaggaggggatttataga
ataaaaaacatggtagagaagccaaaagtagaagaagctccttcaaatttaattataaca
ggagcttatttattgtcaccaaaaatatttgaaaagattagagaaactccaccaggaaga
ggaggggaaatccaaattacagatgccatgaatttattgttaaaggaggaagagattata
ggagttgagattaactgtaagagatatgatattggagatgttcttggatggttaaaggca
aatgtagagattggagctgaaaaattccctgaatttagagagtttttaaaggagtttgtt
aaaaatctactttga

DBGET integrated database retrieval system