KEGG   Methanocaldococcus sp. FS406-22: MFS40622_0474Help
Entry
MFS40622_0474     CDS       T01175                                 

Definition
(GenBank) pyruvate/ketoisovalerate oxidoreductase, gamma subunit
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
mfs  Methanocaldococcus sp. FS406-22
Pathway
mfs00010  Glycolysis / Gluconeogenesis
mfs00020  Citrate cycle (TCA cycle)
mfs00620  Pyruvate metabolism
mfs00633  Nitrotoluene degradation
mfs00640  Propanoate metabolism
mfs00650  Butanoate metabolism
mfs00680  Methane metabolism
mfs00720  Carbon fixation pathways in prokaryotes
mfs01100  Metabolic pathways
mfs01120  Microbial metabolism in diverse environments
mfs01130  Biosynthesis of antibiotics
mfs01200  Carbon metabolism
Module
mfs_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
mfs_M00620  Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mfs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MFS40622_0474
   00020 Citrate cycle (TCA cycle)
    MFS40622_0474
   00620 Pyruvate metabolism
    MFS40622_0474
   00640 Propanoate metabolism
    MFS40622_0474
   00650 Butanoate metabolism
    MFS40622_0474
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MFS40622_0474
   00680 Methane metabolism
    MFS40622_0474
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    MFS40622_0474
Enzymes [BR:mfs01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     MFS40622_0474
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR DUF1425
Motif
Other DBs
NCBI-ProteinID: ADC69166
JGI: MFS40622_0474
UniProt: D3S806
Position
456685..457224
Genome map
AA seq 179 aa AA seqDB search
MIEIRFHGRGGQGAVTAAQILAKAAFYDGKFCQAFPFFGVERRGAPVMAFTRIDDKKITL
RCQIYEPDYVVVQDATLLESVNVVEGLKKDGAVIINTVKDDLDLGYKTYTIDATGIALDV
LGVPIVNTAMVGAFAGVTGIVSIESVKKAILDTFKGKLGEKNAKAAEVAYNEMLKKYKK
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgatagaaattagattccatggaagaggaggacaaggtgctgttaccgccgctcaaata
ttagctaaagctgctttttatgatggaaagttctgccaagcatttccgttctttggtgtt
gagagaagaggagctccagttatggcattcacaagaatagatgacaaaaaaatcacatta
agatgccaaatttatgagccagattatgttgttgttcaagatgctactcttttagagagt
gttaatgttgttgaggggttaaagaaagatggggcagttataattaacactgttaaggat
gatttggatttaggttacaaaacatacacaattgacgctacaggaatagccttagatgtt
ttaggagttcctattgtaaatactgcaatggttggagcttttgctggagttacagggatt
gttagcatagaatcagttaaaaaagctattttagacacatttaaaggaaaattaggagag
aaaaacgctaaggcagctgaagttgcttataatgagatgttaaagaagtataaaaagtaa

DBGET integrated database retrieval system