KEGG   Methanocaldococcus sp. FS406-22: MFS40622_0476Help
Entry
MFS40622_0476     CDS       T01175                                 

Definition
pyruvate flavodoxin/ferredoxin oxidoreductase domain protein
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
mfs  Methanocaldococcus sp. FS406-22
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mfs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MFS40622_0476
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MFS40622_0476
   00020 Citrate cycle (TCA cycle)
    MFS40622_0476
   00620 Pyruvate metabolism
    MFS40622_0476
   00640 Propanoate metabolism
    MFS40622_0476
   00650 Butanoate metabolism
    MFS40622_0476
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MFS40622_0476
   00680 Methane metabolism
    MFS40622_0476
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    MFS40622_0476
Enzymes [BR:mfs01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     MFS40622_0476
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
457516..458676
Genome map
AA seq 386 aa AA seqDB search
MCEVKVITGTSAAAEAAKLADVDVVAAYPITPQTTCVEKLAEFVANGELDAEYIKVESEH
SAMSACIGAAATGARTFTATASQGLALMHEMLFIASGMRLPIVMMVANRALSAPINIWND
HQDSIAERDTGWIQIYVEDNQETLDSIIQAYKIAENEDVLLPVMVCLDGFILTHTVEPVT
IPKAERVREFLGVYEPKHAYLDPDRPITQGPVGVPDCYMETRKQIEEAMERAKKVIKDVN
EEFAEWFKRKYGNGLVEAYNLENADTVLVAIGSVCGTIKYVIDELKKEGKEVGLLRIRTF
RPFPKKDVKELLKDANNIAVLDKNISLGVNKGALGIEMASILKNKKVCNYIVGLGGRDVK
IEDIKAIINHVEKSEDDATLWVGLKE
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgaagttaaagttattacaggaacttcagcagctgctgaagcggctaaattagct
gatgttgatgttgttgcggcttatccaatcacaccacaaacgacatgtgttgagaagtta
gctgagtttgtagctaacggggagttagatgctgaatatataaaagttgagagtgagcat
tcagcaatgtctgcctgtattggagcagctgcaactggagcaaggacatttacggcaact
gcctctcaaggtctggctttgatgcatgaaatgctctttattgcctctggaatgagattg
ccaatagtcatgatggttgctaacagggctttatcagctcctataaatatatggaacgac
caccaagattcaatagcagagagagacactggatggattcagatatatgttgaagacaac
caagagactcttgacagcattatacaagcctataagattgctgaaaatgaagatgtttta
ttaccagttatggtttgtttagatgggtttatcttaacccacacagtagagccagtaaca
atcccaaaagcagagagagttagagagtttttaggagtttatgaaccaaaacacgcatac
ttagatccagatagaccaataactcaaggacctgttggagttccagattgttacatggag
acaagaaagcagatagaagaagctatggaaagagctaagaaagtaattaaagatgttaat
gaggaatttgcagagtggtttaagaggaagtatggaaatggtttagttgaagcatacaac
ttagagaatgcagacactgtattggtagcaataggttctgtctgtggaacaataaaatac
gttattgatgagcttaaaaaagaagggaaagaagttggattgttaagaataaggacattt
agaccatttccaaaaaaggatgttaaagagttattaaaagatgccaacaatatagctgta
ttggataaaaacatttcattaggtgttaataagggagctttaggtattgaaatggcatca
attttaaagaataagaaggtttgcaactacattgttggattgggaggaagagatgttaaa
atagaggatattaaagcaataattaaccatgttgagaagtcagaggatgacgcaacttta
tgggtaggattaaaggaataa

DBGET integrated database retrieval system