KEGG   Methanocaldococcus sp. FS406-22: MFS40622_0477Help
Entry
MFS40622_0477     CDS       T01175                                 

Definition
thiamine pyrophosphate protein domain protein TPP-binding protein
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
mfs  Methanocaldococcus sp. FS406-22
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mfs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MFS40622_0477
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MFS40622_0477
   00020 Citrate cycle (TCA cycle)
    MFS40622_0477
   00620 Pyruvate metabolism
    MFS40622_0477
   00640 Propanoate metabolism
    MFS40622_0477
   00650 Butanoate metabolism
    MFS40622_0477
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MFS40622_0477
   00680 Methane metabolism
    MFS40622_0477
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    MFS40622_0477
Enzymes [BR:mfs01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     MFS40622_0477
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
458705..459592
Genome map
AA seq 295 aa AA seqDB search
MQFPREELFAPGHRGCAGCGAAIVARLLLKAAGKNTIISNATGCLEVMTTPYPETSWRVP
WIHTAFENAAATASGIEAAIKALKRKRGKYADKKINVIAIGGDGGTADIGFQALSGAMER
GHNILYVMYDNEAYMNTGIQRSSSTPFMAATTTSPAGSKIRGEDRPKKDMTMIMAAHGIP
YVATACISYPEDFMRKVKKALSIEGPKFIQVLQPCTTGWGYPPEKTIEIGRLAVETGVFP
LYEIENGDFRITYKPAKRKPVREYLKMQKRYRHLTDEDIERIQRYIDEKCKLLGL
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgcaatttccaagagaagaattatttgctccagggcatagaggatgtgctggttgtgga
gcggcaattgtagcaagattgcttttaaaggcggctggaaaaaacaccattatatcaaac
gctactggatgtttagaggttatgacaacaccatatccagagacatcatggagagttcct
tggattcatactgcctttgaaaatgcagcggcaacagcaagtggtattgaggcggctata
aaagcattaaagagaaagagaggtaaatatgctgataaaaaaataaatgtcattgcaatt
ggaggagatggaggaacagcagatattggttttcaggcattaagtggggctatggaaaga
gggcataatatactatatgttatgtatgacaacgaggcatacatgaacaccggaatacag
agaagttcatcaacacctttcatggctgctacaacaacatctccagctggttcaaaaatt
agaggggaagatagacctaaaaaagatatgacaatgataatggcggctcatggaattcct
tacgttgctactgcatgcatttcatatccagaagactttatgagaaaggttaaaaaggca
ttgagcattgaaggtcctaaatttatacaagttttacagccttgtacaacaggttgggga
tatccaccagaaaaaacaatagaaattggaagattggcagttgaaacaggagttttccca
ctctatgagattgaaaatggggatttcagaattacctacaaaccagctaagaggaaaccc
gttagagagtatctaaagatgcagaaaaggtatagacacttaactgatgaagatattgaa
agaattcagagatatatcgacgaaaagtgtaagttattggggctttaa

DBGET integrated database retrieval system