KEGG   Methanocaldococcus sp. FS406-22: MFS40622_0653Help
Entry
MFS40622_0653     CDS       T01175                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
mfs  Methanocaldococcus sp. FS406-22
Pathway
mfs00260  Glycine, serine and threonine metabolism
mfs00750  Vitamin B6 metabolism
mfs01100  Metabolic pathways
mfs01110  Biosynthesis of secondary metabolites
mfs01120  Microbial metabolism in diverse environments
mfs01230  Biosynthesis of amino acids
Module
mfs_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mfs00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MFS40622_0653
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    MFS40622_0653
Enzymes [BR:mfs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     MFS40622_0653
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ADC69341
JGI: MFS40622_0653
UniProt: D3S8I1
Position
656855..658072
Genome map
AA seq 405 aa AA seqDB search
MLQRCIECGKTYDVDEIVYTCECGGLLEIIYDYEEIKDKVSKEKLREREIGVWRYIEYLP
VKDESKIVSLCEGGTPLYRCKNLEKELGVKELYVKNEGANPTGSFKDRGMTVGVTRANEL
GVEIVGCASTGNTSASLAAYSARCGKKCIVLLPEGKVALGKLAQAMFYGAKVIQVKGNFD
DALDMVKQLAKEKLIYLLNSINPFRLEGQKTIAFEICDQLNWQVPDRVIVPVGNAGNISA
IWKGFKEFEMTGIIDELPKMTGIQAEGAKPVVEAFRKRAKTIVPYKNPETIATAIRIGNP
VNAPKALDAIYSSGGYAEAVTDEEIVEAQKLLARKEGIFVEPASASSIAGLKKLLEEGVI
DRDERIVCITTGHGLKDPDAAIRASEEPIKIECDMEVLKRILREL
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgttacaaagatgtattgaatgtggaaaaacatatgatgttgatgagatagtctatacc
tgcgaatgtggtggcttattggagattatctatgattatgaggagataaaggataaagtt
tcaaaagagaagcttagagaaagagaaattggggtttggaggtatatagaatatctacca
gtaaaagatgaaagcaaaattgttagtttatgtgaaggaggaactccattatatagatgc
aaaaatttagagaaagagttgggagttaaagaactctatgttaaaaatgaaggggcaaac
ccaactggtagctttaaagataggggaatgactgttggtgtaacgagagctaatgagtta
ggggttgagattgttggctgtgcatcaactggaaacacatcagcatctttagccgcttac
tcagcaagatgtggaaagaagtgcatagttttattaccagaaggaaaggtagctttagga
aagttggctcaagcaatgttttatggagctaaggttatccaagtcaaaggaaactttgat
gatgccttagatatggttaagcagttggcaaaggaaaaattaatttatttattaaattca
ataaatccgtttagattagaggggcagaaaacaattgcttttgagatttgtgaccaacta
aattggcaagttccagatagagttatagtcccagtaggaaatgctggaaacatctcagct
atatggaagggatttaaggagtttgaaatgactggaattattgatgagttgccaaagatg
actggaattcaagcagaaggggctaaaccagttgttgaagcatttagaaagagagctaaa
actatagttccatacaaaaatccagagacaattgcaacagccataaggattggaaatcca
gtaaatgctccaaaggcattagatgctatatattcctctggaggttatgctgaggcagtt
actgatgaggaaattgttgaggcacaaaagttattggcaaggaaggagggaatttttgtt
gaaccagcttcagcatcatcaatagctggattaaaaaagctattagaagaaggagttatt
gatagagatgagagaattgtttgtataacaactgggcatggattaaaagacccagatgct
gctataagagcaagtgaagagccaattaagattgaatgtgatatggaagttttaaagagg
attttgagagagttataa

DBGET integrated database retrieval system