KEGG   Methanocaldococcus sp. FS406-22: MFS40622_0757Help
Entry
MFS40622_0757     CDS       T01175                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mfs  Methanocaldococcus sp. FS406-22
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mfs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MFS40622_0757
   01230 Biosynthesis of amino acids
    MFS40622_0757
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MFS40622_0757
   00051 Fructose and mannose metabolism
    MFS40622_0757
   00562 Inositol phosphate metabolism
    MFS40622_0757
Enzymes [BR:mfs01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MFS40622_0757
Exosome [BR:mfs04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MFS40622_0757
  Exosomal proteins of bladder cancer cells
   MFS40622_0757
  Exosomal proteins of melanoma cells
   MFS40622_0757
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
756480..757139
Genome map
AA seq 219 aa AA seqDB search
MLIVINYKTYKESIGKRGLEIAKAAEKVSEESGITIGVAPQFVDLRMIVENVNIPVYAQH
IDNINPGSHTGHILAEAIKDCGCKGTLINHSEKRMLLADIEAVINRCKDLGLETIVCTNN
VNTSKAVAALSPDYIAVEPPELIGTGIPVSKANPEVVEGTVKAVKEINKDVKVLCGAGIS
KGEDVKAALDLGAEGVLLASGVVKAKNVEEAIRELIKFI
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgttgattgtaattaactacaagacatacaaggagagtattggaaagagaggtttggag
atagctaaagctgccgagaaagttagtgaggaaagtggaattaccattggggtagctcct
cagtttgtagatttaaggatgattgttgaaaatgttaatattccagtttatgctcaacat
atagataacataaatcctggaagtcatactggacatatattagctgaggcaattaaagat
tgtggttgtaagggaactttaataaatcactcagagaagagaatgcttttagctgatatt
gaagcagttataaatagatgtaaagatttaggattagagacaattgtctgcacaaacaat
gtaaatacttccaaggcagttgcagctctaagccctgattatattgcagttgaaccacca
gagcttataggaactggcattccagtatcaaaggcaaatccagaggtcgttgagggaact
gttaaagcggttaaagagataaataaggatgttaaagtgttatgtggagctggaatatct
aaaggagaggatgttaaggcagctcttgatttaggggcagagggtgttttattagcttct
ggagtagttaaagcgaagaatgtagaagaggcaataagagaattaataaaattcatttaa

DBGET integrated database retrieval system