KEGG   Methanocaldococcus sp. FS406-22: MFS40622_0757Help
Entry
MFS40622_0757     CDS       T01175                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mfs  Methanocaldococcus sp. FS406-22
Pathway
mfs00010  Glycolysis / Gluconeogenesis
mfs00051  Fructose and mannose metabolism
mfs00562  Inositol phosphate metabolism
mfs01100  Metabolic pathways
mfs01110  Biosynthesis of secondary metabolites
mfs01120  Microbial metabolism in diverse environments
mfs01130  Biosynthesis of antibiotics
mfs01200  Carbon metabolism
mfs01230  Biosynthesis of amino acids
Module
mfs_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mfs_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mfs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MFS40622_0757
   00051 Fructose and mannose metabolism
    MFS40622_0757
   00562 Inositol phosphate metabolism
    MFS40622_0757
Enzymes [BR:mfs01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MFS40622_0757
Exosome [BR:mfs04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MFS40622_0757
  Exosomal proteins of bladder cancer cells
   MFS40622_0757
  Exosomal proteins of melanoma cells
   MFS40622_0757
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM NMO FMN_dh His_biosynth ThiG IGPS Glu_synthase Hydrolase_6 Hydrolase_like PHP PcrB
Motif
Other DBs
NCBI-ProteinID: ADC69442
JGI: MFS40622_0757
UniProt: D3S3M8
Position
756480..757139
Genome map
AA seq 219 aa AA seqDB search
MLIVINYKTYKESIGKRGLEIAKAAEKVSEESGITIGVAPQFVDLRMIVENVNIPVYAQH
IDNINPGSHTGHILAEAIKDCGCKGTLINHSEKRMLLADIEAVINRCKDLGLETIVCTNN
VNTSKAVAALSPDYIAVEPPELIGTGIPVSKANPEVVEGTVKAVKEINKDVKVLCGAGIS
KGEDVKAALDLGAEGVLLASGVVKAKNVEEAIRELIKFI
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgttgattgtaattaactacaagacatacaaggagagtattggaaagagaggtttggag
atagctaaagctgccgagaaagttagtgaggaaagtggaattaccattggggtagctcct
cagtttgtagatttaaggatgattgttgaaaatgttaatattccagtttatgctcaacat
atagataacataaatcctggaagtcatactggacatatattagctgaggcaattaaagat
tgtggttgtaagggaactttaataaatcactcagagaagagaatgcttttagctgatatt
gaagcagttataaatagatgtaaagatttaggattagagacaattgtctgcacaaacaat
gtaaatacttccaaggcagttgcagctctaagccctgattatattgcagttgaaccacca
gagcttataggaactggcattccagtatcaaaggcaaatccagaggtcgttgagggaact
gttaaagcggttaaagagataaataaggatgttaaagtgttatgtggagctggaatatct
aaaggagaggatgttaaggcagctcttgatttaggggcagagggtgttttattagcttct
ggagtagttaaagcgaagaatgtagaagaggcaataagagaattaataaaattcatttaa

DBGET integrated database retrieval system