KEGG   Methanocaldococcus sp. FS406-22: MFS40622_0762Help
Entry
MFS40622_0762     CDS       T01175                                 

Definition
histone acetyltransferase, ELP3 family (EC:2.3.1.48)
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
mfs  Methanocaldococcus sp. FS406-22
Brite
Enzymes [BR:mfs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     MFS40622_0762
Transfer RNA biogenesis [BR:mfs03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    MFS40622_0762
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
761705..763318
Genome map
AA seq 537 aa AA seqDB search
MDEKAKLMRCIIERILDEYNRGNTLDKKRIEQIKAECLRIHRIGIGHPSNSEILQYATEE
EKKILIPILRKKPVRTISGVAVVAVMTSPEKCPHGKCIFCPGGVGSVFGDVPQSYTGREP
ATMRGLMFNFDPYLQTKARIEQLEKVGHPTNKIELIIMGGTFPAREIAYQDWFIKRCLDA
MNGVDASSLEEAQKINETAEHRCVALCIETRPDCCGEKEINQMLKLGTTRVELGVQTIYN
EILEFCKRGHTVEDTIKATQLLKDSGLKVSYHLMPGMPGSDMEMDKKMFKEIFSNPDFMP
DMVKIYPCLVIEGTELYEMWKKGLYKPYREEEAIEIIAYAKSIMPKWVRTSRIQRDIPAT
VIVDGVKKSNLGELVYKYMEKHGIKCKCIRCREVGHVMYKKGIMPEIEHIKLCREEYEAS
GGTEIFLSYEDVKNDILIAFLRLREPYKPFRKEIDDNTMLVRQLHVCGQEKPLTKDLKEI
TWQHKGYGRKLLEEAERIAKEEFGKKKILVTSGIGVREYYRKLGYERIGAYMGKYLE
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atggatgaaaaagccaaattaatgagatgcatcattgaaagaatcttagatgaatacaac
aggggaaacaccttagataaaaagagaattgagcagataaaggcagagtgcttaagaatt
catagaattggtattggacatccatcaaactctgaaatcttacagtatgcaactgaagaa
gagaagaagatattaatccctatattaagaaagaagccagttagaacaatctccggagtg
gcagttgtagcagttatgacctctccagaaaaatgccctcatggaaaatgcatcttctgc
cccggaggagttggaagtgtgtttggagatgtgccacaaagctacactggaagagaacca
gctactatgagaggtttaatgttcaacttcgacccatacttacaaacaaaagcaaggatt
gagcaattggaaaaggtagggcatccaacaaacaagatagagcttattataatgggagga
acatttccagcaagagaaatagcttatcaagattggtttattaagagatgcttagatgct
atgaacggtgttgatgcaagtagtttggaagaagcccaaaagattaatgaaactgctgaa
catagatgtgtagctctctgtatagaaacaaggccagattgttgtggagagaaggagata
aaccaaatgctaaaattagggactacaagggtagagttgggagttcaaacaatctacaat
gagattttagaattctgcaagagaggtcatacagttgaagacacaataaaagcaacccaa
ttattaaaagatagtggtttgaaggtttcttatcacttaatgccgggaatgcccggctct
gatatggagatggacaaaaagatgtttaaagagatatttagcaatccagactttatgccg
gatatggttaaaatctatccatgcttggttattgaaggaactgaactctatgagatgtgg
aaaaaggggctttataaaccatacagagaagaggaggcaatagaaataattgcctatgca
aagtcaataatgccaaaatgggttagaacttcaaggattcagagggatatcccagctaca
gtaatagttgatggagttaagaagagcaatttgggagagttggtttataaatacatggaa
aagcatggaattaaatgcaagtgcataagatgcagagaagttgggcatgttatgtataaa
aaaggaataatgccagagatagagcatataaaactatgcagagaggagtatgaggcaagt
ggtgggactgagatatttttatcctatgaggatgtaaaaaacgatattttaatagcattt
ttaagattgagggagccatataagccatttagaaaggagattgatgataacaccatgtta
gttagacaactccatgtttgtgggcaagaaaaaccattaaccaaggatttgaaggaaatt
acatggcaacataagggttatggaagaaaacttttagaagaggctgaaaggatagcaaaa
gaagaatttggaaagaagaagattttggtaacaagtggtattggagttagagaatactac
agaaagttaggatatgaaagaattggggcttatatgggcaaatacttagaataa

DBGET integrated database retrieval system