KEGG   Methanocaldococcus sp. FS406-22: MFS40622_0798Help
Entry
MFS40622_0798     CDS       T01175                                 

Definition
4Fe-4S ferredoxin iron-sulfur binding domain protein
Orthology
K00204  
4Fe-4S ferredoxin
Organism
mfs  Methanocaldococcus sp. FS406-22
Pathway
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Methanogenesis, CO2 => methane
Methanogen
Class
Metabolism; Overview; Carbon metabolism [PATH:mfs01200]
Metabolism; Energy metabolism; Methane metabolism [PATH:mfs00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
795973..796413
Genome map
AA seq 146 aa AA seqDB search
MPEHILSGIKAIVAMKLRRKGLLQREIAKIIKSDRSIISHYLSGRYPKEKILKVAKTVEE
LPPECGAKLVHSLTDDKELAKNLIKELYCIELFWDENSCIACGSCLGCAALTLNNFVVNI
NHDYCHLCASCIFRCPTNSLKFIKEE
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgccagagcatattctttctggaataaaggcaatagtggcaatgaaattaagaagaaaa
gggcttttgcagagggaaatagcaaaaattatcaagagtgatagatcaatcatctctcat
tatctctctggaagatatccaaaggagaaaatcctaaaagtggcaaaaactgttgaagaa
cttcctccagagtgcggagctaagcttgtccattctttaactgacgataaagagcttgca
aagaacttaataaaagagttatactgcatagagcttttctgggatgaaaattcctgcata
gcttgcggttcttgtttggggtgtgcagcactcacactcaataactttgtagtaaatata
aatcatgactactgccatctatgtgcatcctgcatatttagatgtcctacaaactcatta
aaattcattaaggaggaataa

DBGET integrated database retrieval system