KEGG   Methanocaldococcus sp. FS406-22: MFS40622_0869Help
Entry
MFS40622_0869     CDS       T01175                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mfs  Methanocaldococcus sp. FS406-22
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mfs00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    MFS40622_0869
Enzymes [BR:mfs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     MFS40622_0869
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
870128..870688
Genome map
AA seq 186 aa AA seqDB search
MDKKLFIEICRRLYDRKYVVGSGGNVSVREGDKIYLTPTGSILGFLKEDEIAEVDLDGNV
IKGKPTSEKNLHLMIYRKRDDINAIIHTHSLISTFLSTIDKEIELLTPEGKIFLKKIGYV
DYFEAGSLKLAEETAKRDEDVIILKNHGVVCLGKDLMDAYIKVEVLEEQAKLTLLNHLVK
RNKNLF
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atggacaaaaagctatttattgaaatatgtagaagattgtatgatagaaaatatgtcgta
ggtagtggaggtaatgtgtctgttagagagggagataaaatatacctaactccaactggt
tctattttaggatttttgaaagaagatgaaatagctgaagttgatttagatggtaatgtt
ataaaaggaaaacccacatcagaaaaaaatctccacttaatgatttatagaaaaagagat
gatataaacgcaataattcacacccactctcttatatcaacttttttatcaactatagat
aaggagattgaacttttaacaccagagggaaaaatatttttaaagaaaattggatatgtt
gattattttgaggcaggtagtttaaaattagctgaagaaactgcaaagagagatgaagat
gtaattatattaaaaaatcatggtgttgtgtgcttaggaaaagatttgatggatgcctat
ataaaagtggaggttttagaagaacaagcaaagcttacacttttaaaccatcttgtaaaa
agaaataaaaatcttttttaa

DBGET integrated database retrieval system