KEGG   Methanocaldococcus sp. FS406-22: MFS40622_0930Help
Entry
MFS40622_0930     CDS       T01175                                 

Definition
tyrosyl-tRNA synthetase
Orthology
K01866  
tyrosyl-tRNA synthetase [EC:6.1.1.1]
Organism
mfs  Methanocaldococcus sp. FS406-22
Pathway
Aminoacyl-tRNA biosynthesis
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:mfs00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(924102..925007)
Genome map
AA seq 301 aa AA seqDB search
MIKRNTSEIISEEELKEVLTKDEKSAYIGFEPSGKIHLGHYLQIKKMIDLQNAGFDIIIL
LADLHAYLNQKGELDEIRKIGEYNKRVFEAMGLKAKYVYGSEFQLDKDYTLNVYKLALKT
TLKRARRSMELIAREDENPKVAEVIYPIMQVNDIHYLGVDVAVGGMEQRKIHMLARELLP
KKVVCIHNPVLTGLDGEGKMSSSKGNFIAVDDSPEEIKAKIKKAYCPAGVVEGNPIMEIA
KYFLEYPLTINRPEKYGGDLVVNSYEELETLFKNKELHPMDLKNAVAEELIKILEPIRKR
L
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgataaagagaaacacatctgaaattatcagcgaggaggaattaaaagaagtcttaaca
aaggatgaaaaatctgcttacataggttttgagccaagcggtaaaatccatttagggcat
tatctccaaataaaaaagatgattgacttacaaaatgctggatttgatattattatattg
ttagctgatttacatgcatatttaaaccagaaaggagagttggatgagattagaaaaata
ggagaatacaataaaagagtctttgaagctatgggattaaaggcaaaatatgtatatgga
agtgaatttcagcttgataaggattatacactaaatgtttataaattagctttaaaaact
accttaaagagagcgagaaggagtatggaacttatagcaagagaggatgaaaacccaaag
gttgctgaagttatatatccaataatgcaggttaatgacatccactatttgggtgttgat
gttgcggttgggggaatggagcagagaaagatacacatgttagcgagagagttgctacca
aaaaaggttgtttgcatccacaacccagtattaactggtttagatggagaaggaaagatg
agttcttcaaaggggaattttatagctgttgatgattctccagaagagattaaagccaag
ataaaaaaagcctactgccccgctggagttgttgaaggcaacccaatcatggagatagct
aaatatttccttgaatatcctttaactataaacagaccagagaagtacgggggagattta
gttgttaatagctatgaagagttagagacattatttaaaaataaagaacttcacccaatg
gatttaaaaaatgccgttgctgaagagcttataaagattttagagccaattaggaagagg
ctataa

DBGET integrated database retrieval system