KEGG   Methanocaldococcus sp. FS406-22: MFS40622_0930Help
Entry
MFS40622_0930     CDS       T01175                                 

Definition
tyrosyl-tRNA synthetase
Orthology
K01866  
tyrosyl-tRNA synthetase [EC:6.1.1.1]
Organism
mfs  Methanocaldococcus sp. FS406-22
Pathway
Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:mfs00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    MFS40622_0930
Enzymes [BR:mfs01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.1  tyrosine---tRNA ligase
     MFS40622_0930
Amino acid related enzymes [BR:mfs01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   MFS40622_0930
Transfer RNA biogenesis [BR:mfs03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    MFS40622_0930
 Prokaryotic Type
    MFS40622_0930
Mitochondrial biogenesis [BR:mfs03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    MFS40622_0930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(924102..925007)
Genome map
AA seq 301 aa AA seqDB search
MIKRNTSEIISEEELKEVLTKDEKSAYIGFEPSGKIHLGHYLQIKKMIDLQNAGFDIIIL
LADLHAYLNQKGELDEIRKIGEYNKRVFEAMGLKAKYVYGSEFQLDKDYTLNVYKLALKT
TLKRARRSMELIAREDENPKVAEVIYPIMQVNDIHYLGVDVAVGGMEQRKIHMLARELLP
KKVVCIHNPVLTGLDGEGKMSSSKGNFIAVDDSPEEIKAKIKKAYCPAGVVEGNPIMEIA
KYFLEYPLTINRPEKYGGDLVVNSYEELETLFKNKELHPMDLKNAVAEELIKILEPIRKR
L
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgataaagagaaacacatctgaaattatcagcgaggaggaattaaaagaagtcttaaca
aaggatgaaaaatctgcttacataggttttgagccaagcggtaaaatccatttagggcat
tatctccaaataaaaaagatgattgacttacaaaatgctggatttgatattattatattg
ttagctgatttacatgcatatttaaaccagaaaggagagttggatgagattagaaaaata
ggagaatacaataaaagagtctttgaagctatgggattaaaggcaaaatatgtatatgga
agtgaatttcagcttgataaggattatacactaaatgtttataaattagctttaaaaact
accttaaagagagcgagaaggagtatggaacttatagcaagagaggatgaaaacccaaag
gttgctgaagttatatatccaataatgcaggttaatgacatccactatttgggtgttgat
gttgcggttgggggaatggagcagagaaagatacacatgttagcgagagagttgctacca
aaaaaggttgtttgcatccacaacccagtattaactggtttagatggagaaggaaagatg
agttcttcaaaggggaattttatagctgttgatgattctccagaagagattaaagccaag
ataaaaaaagcctactgccccgctggagttgttgaaggcaacccaatcatggagatagct
aaatatttccttgaatatcctttaactataaacagaccagagaagtacgggggagattta
gttgttaatagctatgaagagttagagacattatttaaaaataaagaacttcacccaatg
gatttaaaaaatgccgttgctgaagagcttataaagattttagagccaattaggaagagg
ctataa

DBGET integrated database retrieval system