KEGG   Methanocaldococcus sp. FS406-22: MFS40622_1055Help
Entry
MFS40622_1055     CDS       T01175                                 

Definition
Porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
mfs  Methanocaldococcus sp. FS406-22
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mfs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MFS40622_1055
Enzymes [BR:mfs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     MFS40622_1055
Exosome [BR:mfs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MFS40622_1055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1055682..1056650
Genome map
AA seq 322 aa AA seqDB search
MLIRPRRLRKNQKIRDLVRETVLTKNDLIMPIFVDEHLKGNEKKKINSMPNQYRFSVEGA
IEEAKKIADLGIPAVILFGIPKYKDEIASSAYDKNGVVQRTIRGIKEELGDELLVIADCC
LCEYTSHGHCGIVKNGKILNDATLPILAKIALSYAEAGVDIVAPSDMMDGRVKAIREVLE
ENGYDDVAIMSYSAKYASSFYGPFREAAESAPKFGDRKSYQMDIGNAREAMKEIALDIEE
GADLILVKPALPYLDIIRMAKDRFDVPIGGYCVSGEYAMVEAAARNGWLDREKVIYEILL
SIKRAGADFIITYWAKEVAEKL
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgttaataagaccaaggagattaagaaaaaaccaaaaaattagagatttagttagagaa
acagtcttaacaaaaaatgatttaataatgccaatctttgtagatgaacatttaaaaggg
aatgaaaaaaagaagattaactcaatgccgaatcagtataggtttagtgtggaaggagcc
atagaagaagctaagaagatagctgatttaggcattccagctgtaatattgtttggtatt
ccaaaatataaggatgaaatagcaagctctgcctatgacaaaaatggggttgtgcagaga
actataaggggaattaaagaggagttaggagatgaacttttggttattgctgactgctgt
ttgtgtgaatatacaagccatggacactgcggaatagttaaaaatggaaagatattaaat
gatgctaccctccctatattggcaaagatagctttatcctatgccgaggctggggttgat
atcgttgctccttcagacatgatggatggaagagttaaagctataagagaggttttagag
gaaaatggctatgatgatgttgctataatgagctattctgccaaatatgcatcatcgttt
tatgggccttttagggaggctgctgaaagtgctccaaagtttggagatagaaagagctat
cagatggacattggaaatgcaagagaagcaatgaaagagattgccttggatatagaggag
ggggctgatttgattttggttaagccggctctaccatacttagatataataaggatggct
aaagataggtttgatgtgcctattggtggttactgcgttagtggggagtatgcaatggtt
gaagcagcagcaagaaatggatggttagatagggaaaaggttatttatgaaatactgcta
agtataaaaagggctggagctgattttatcattacatattgggctaaggaggttgctgaa
aaattatag

DBGET integrated database retrieval system