KEGG   Methanocaldococcus sp. FS406-22: MFS40622_1081Help
Entry
MFS40622_1081     CDS       T01175                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
mfs  Methanocaldococcus sp. FS406-22
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:mfs00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    MFS40622_1081
Enzymes [BR:mfs01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     MFS40622_1081
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1077878..1078732)
Genome map
AA seq 284 aa AA seqDB search
MEGYFIDLSKFMMANSSYEEAKGVIFSIPYDETTSFKPGAREGGNAIRTASWGLEAYSPI
LDRDLSDLKYCDLKDLDLYGNQKEIFNTIHSVSREILKDNKKIIVFGGEHSITYPIIKAV
KDIYNEFIVIQFDAHCDLRDEYLGNKLSHACVMRRVYELTKDIFQFGIRSGDKEEWNFAK
KNDLYLKMDLMNKEDLEYIKSLNKPIYITIDIDVLDPAYAPGTGTPEPCGFSTKELFKSL
YLLEEVKDRIIGFDIVEVSPIYDIANITAITAAKIARELMLMIL
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggaaggatattttattgatttatctaaatttatgatggcaaatagttcttatgaagaa
gctaagggagttatattctcaatcccttatgacgaaacaacttcttttaaaccaggagca
agagagggaggaaatgctataagaacagcatcgtggggattagaagcatacagcccaatc
ttagatagggatttgtcagatttaaaatactgtgatttaaaagatttggatttgtatgga
aatcaaaaagagatattcaatacaatacattcagtttcaagagagatattaaaagataac
aagaaaataattgtctttggaggagagcattctataacttatccaataattaaggctgta
aaagatatctataatgagtttattgttattcaattcgatgcccattgtgatttgagagat
gaatatttgggaaataaattatctcacgcatgcgttatgaggagagtttatgaactaact
aaagatatattccaatttggaattaggagtggagataaagaagagtggaattttgcaaag
aaaaacgatctctatttaaagatggatttgatgaataaggaggatttggagtatataaag
agtctaaataagccgatatatataaccatagatattgatgtattagaccccgcctatgcc
cctgggactgggactcctgaaccatgcggtttttcaacaaaggagttatttaagtcctta
tatttattagaagaggttaaagataggattattggctttgatattgttgaagtttcacca
atttatgatattgccaatattacagcaataacagcggcaaaaatagcgagagagcttatg
ttaatgattttataa

DBGET integrated database retrieval system