KEGG   Methanocaldococcus sp. FS406-22: MFS40622_1240Help
Entry
MFS40622_1240     CDS       T01175                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mfs  Methanocaldococcus sp. FS406-22
Pathway
mfs00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mfs01100  Metabolic pathways
mfs01110  Biosynthesis of secondary metabolites
mfs01130  Biosynthesis of antibiotics
mfs01230  Biosynthesis of amino acids
Module
mfs_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mfs00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MFS40622_1240
Enzymes [BR:mfs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     MFS40622_1240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ADC69917
JGI: MFS40622_1240
UniProt: D3S503
Position
1216461..1217261
Genome map
AA seq 266 aa AA seqDB search
MKVLDEIVKNRKKLIEIEKRKDIIKNLRSLIDELNIDVEKKKKLKLSKAIKKAKEIKNPI
ITEIKPSSPSKGNIREMNLEDVKNIAKEMVEGGATALSILTEPKYFNGSYHNLIVAREVN
IPILMKDFIVDFYQIDIASEIGANAVLLIVSALKEDVGEFLDYAKENNLECLVETHDKDE
IEIALDAGAKIIGINNRDLKTLKIDLSTTERLAPLIPKSKLKVGESGIYTKEQLNYILKF
TDAALIGSSIMESENIKEKVMELVER
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcttagatgaaatcgtcaaaaatagaaaaaaattgattgagatagaaaagagg
aaagacataatcaaaaacttaaggagtcttattgatgaattaaatatagatgtagaaaaa
aagaaaaaattaaagttatcaaaagcgataaaaaaagccaaagaaataaaaaatccaata
atcactgaaattaaaccatcatctccatcaaaaggaaacattagagaaatgaatcttgaa
gatgtaaaaaatattgccaaagaaatggtagaaggtggagcaactgctttatctatctta
acagaaccgaaatatttcaatgggagttatcataatttaattgttgcgagagaagtaaat
attcccatattaatgaaagattttattgttgatttttatcaaatcgatatagccagtgag
attggagctaatgcagttttattaattgtttcagcattaaaagaagatgttggggagttt
ttagattacgctaaagaaaataatttggaatgtttagttgagacacatgacaaggatgag
atagagatagccttagatgctggagctaagattattggcataaacaatagagatttaaaa
acattaaagattgatttatcaacaactgagagattagctccattaatccctaaatctaaa
ctaaaagttggagaaagtggaatatatacaaaagagcagttaaattatattttaaaattt
actgacgctgctttaattggttcttcaataatggaaagtgaaaatataaaagaaaaagtt
atggaattggttgaaaggtga

DBGET integrated database retrieval system