KEGG   Methanocaldococcus sp. FS406-22: MFS40622_1249Help
Entry
MFS40622_1249     CDS       T01175                                 

Definition
Magnesium chelatase (EC:6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
mfs  Methanocaldococcus sp. FS406-22
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mfs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MFS40622_1249
Enzymes [BR:mfs01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     MFS40622_1249
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1223190..1224278
Genome map
AA seq 362 aa AA seqDB search
MQYIYPFTAIVGQEKMKKALILNAINPKIGGVLIRGEKGTAKSTAVRALADLLPEIEVVE
GCPFNCDPNGELCDICKEKKERGELKVTKKKMKVVNLPIGATEDRVIGTLDIEKAIKEGI
KALEPGILAEANRNILYIDEVNLLDDHIIDVLLDVAAMGWNIIEREGVKIKHPSRFILVG
TMNPEEGELRPQILDRFGLMVDVEGLNDVKDRVEVIKRVEEFNNNPEEFYKKFEEEQKKL
REKIIKAREILNKVEISDELLEFISKVCIELGIQTNRADITVVRTAKALAAYNGRTYVTI
DDVKEAMELALPHRMRRKPFEPPQLNKEKLEQMINEFKQQKNNNEEEKEEQKNDDVKKNM
MK
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgcagtatatttatccattcactgcaatcgttggacaggaaaagatgaagaaggcttta
attctaaatgctataaatccaaagattggtggagttttaattaggggagagaaaggaaca
gcaaaatccactgcagttagagctttagctgatttattgccagagattgaagttgttgaa
ggatgcccattcaactgcgacccaaatggagagttgtgtgatatctgcaaagaaaagaaa
gagagaggagagctaaaagtaacaaaaaagaagatgaaggttgttaatcttccaattgga
gctactgaagatagagttattggaactcttgacatagaaaaagctataaaagaaggaatt
aaagcattagagccgggaattttggcagaggcaaatagaaacatcctctacattgatgaa
gttaatttattggatgaccatataattgatgttttattggatgttgcagcaatgggttgg
aacatcattgagagagagggagttaagataaagcatccttcaagatttatattagtagga
actatgaatccagaggagggggagttaagacctcaaattttggatagatttggtttaatg
gttgatgttgaaggattaaatgatgttaaagatagagtagaggttataaagagggttgag
gaatttaacaacaatccagaagagttctataaaaaatttgaagaagaacagaaaaaatta
agagaaaaaataattaaagcaagagaaattttaaataaagttgagataagcgatgaactc
ttagaatttatatcaaaagtttgtattgagttaggaattcaaacaaatagggccgatata
actgttgttagaacagctaaagctttagctgcctataacggaaggacttatgtaactata
gatgatgtcaaggaggctatggagttagctctacctcacagaatgagaagaaaaccattt
gaaccaccacaattaaacaaagagaagttggagcagatgattaatgagtttaaacagcaa
aaaaataataatgaagaagaaaaggaagagcaaaaaaatgatgacgtaaaaaaaaacatg
atgaaataa

DBGET integrated database retrieval system