KEGG   Methanocaldococcus sp. FS406-22: MFS40622_1250Help
Entry
MFS40622_1250     CDS       T01175                                 

Definition
Magnesium chelatase (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
mfs  Methanocaldococcus sp. FS406-22
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mfs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MFS40622_1250
Enzymes [BR:mfs01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     MFS40622_1250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1224275..1225228
Genome map
AA seq 317 aa AA seqDB search
MRNEFEEENEDSNNQNNNNNSNNQNEDTPGDFERTFGIDESFKVNPKLIQFKLKDNIHRY
GSGRHIKSYSKRGRYVKFKLPKDKTSDIAFDATFRRAAIHQKRRREKSNKKLAIYLEKED
IVEKVRQRKISSHILFVVDVSGSMGAMRRMEAAKGAIISLLLDAYQKRNKIGMIAFRKDR
AELILPFTSSVELGEKLLKDLPTGGKTPLADAFIKSYEVFDRELRKNPNIIPIMIVISDF
KPNVAVKGDYVKEVFDACEKIAEKCINVILIDTEPQSFIKIGIGREIANRFGFKYYKIEE
LSEEKILDICKSLEINF
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
ataagaaatgagtttgaagaagaaaatgaggattcaaataatcaaaataataataacaac
tctaataaccaaaatgaagatacacccggggactttgaaagaacgtttggcatagatgag
agctttaaagtaaatcccaagcttatacaatttaagcttaaagataatatccatagatat
ggctctggaaggcatattaaaagctacagcaagagagggaggtatgtaaaattcaagctc
ccaaaggataaaacttccgatattgccttcgatgctacatttagaagagcggcaatacac
caaaaaagaagaagagaaaaatccaataaaaaattagctatctacttagaaaaagaagat
attgtagaaaaggttagacagaggaagatatcatcccatatattgtttgttgttgatgtg
agtggttcaatgggagctatgagaagaatggaagccgcaaaaggggctataatctctcta
ctcttagatgcctatcaaaagaggaacaaaattggaatgattgcatttagaaaagataga
gctgagttgattttaccttttacatcctcagtagagcttggagagaaactacttaaagat
ttaccaactggagggaaaactcctttggctgatgcatttattaagagctatgaggtcttt
gacagagagcttagaaaaaatccaaatatcatcccaataatgattgtaataagtgatttc
aagccgaatgtagctgttaaaggagattatgttaaagaggtttttgatgcgtgtgagaag
atagctgagaagtgcattaacgttatattgatagatactgagccgcaatcatttataaaa
atagggattggaagagagatagccaatagatttggatttaagtattataaaatagaggag
ttaagtgaagaaaaaatcttagatatttgtaagagcttagaaatcaacttctaa

DBGET integrated database retrieval system