KEGG   Methanocaldococcus sp. FS406-22: MFS40622_1312Help
Entry
MFS40622_1312     CDS       T01175                                 

Definition
tetrahydromethanopterin S-methyltransferase subunit C (EC:2.1.1.86)
Orthology
K00579  
tetrahydromethanopterin S-methyltransferase subunit C [EC:2.1.1.86]
Organism
mfs  Methanocaldococcus sp. FS406-22
Pathway
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Methanogenesis, CO2 => methane
Methanogen
Brite
KEGG Orthology (KO) [BR:mfs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MFS40622_1312
  Energy metabolism
   00680 Methane metabolism
    MFS40622_1312
Enzymes [BR:mfs01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.86  tetrahydromethanopterin S-methyltransferase
     MFS40622_1312
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1295076..1295870)
Genome map
AA seq 264 aa AA seqDB search
MSHGGGGHATELYPENQIFAVGVVLSLVGIYLANFLPDNLSMLIGGLLVSAACVAGANTV
RKVAAYGLGTGVPSIGMISLGMGTLAAVAGVLIPKALGITYLVAPILTLIIALVVGYIVG
RLTVNPVGMKIPIMVRSMTYLSVAGAMALLGFTTAYVGSLEPQAFINGALNTGIMALAFI
TAGMAILHPFNACLGPNESHRRTLTLAVACGLITWFVFSVVKLDIISMVVSIILWAIAYV
KFVKMSFKDACAVLHVPEIPKKGE
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgtcacatggaggaggaggtcatgcaactgagctttatcctgaaaaccagatatttgca
gttggagtagttttgtcattagtaggtatttacttagcaaatttcctaccagataacttg
tcaatgttaattgggggtttattagtttcagcagcgtgtgttgcaggagcaaacactgtt
agaaaagtagccgcttatggtcttggtactggggttccatcaattggtatgattagttta
ggtatggggacattagctgctgtagcgggagttttaattccaaaggcattgggaattacc
tatttagtggctcctatattgacattaattattgcattagttgttggatatatcgtagga
agattaacagttaacccggttgggatgaaaattcctatcatggtcagaagtatgacttat
ttatcagtagcaggagcaatggccctattaggatttacaacagcttatgttggaagccta
gaaccacaagcatttattaatggtgctttaaacactggaattatggctttggcatttata
actgcaggtatggctatattacatcctttcaacgcatgtttaggaccaaatgaaagtcat
agaagaacattaacattagcagttgcatgtggtctaataacttggtttgttttctctgtg
gttaaattagacattatctccatggttgtttcaataatattgtgggcaattgcgtatgtg
aagtttgttaagatgtcattcaaagatgcatgtgcagtattacatgttccagaaattcct
aagaagggagagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system