KEGG   Myxococcus fulvus: LILAB_01145Help
Entry
LILAB_01145       CDS       T01558                                 

Definition
NAD dependent epimerase/dehydratase family protein
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
mfu  Myxococcus fulvus
Brite
Enzymes [BR:mfu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     LILAB_01145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
273427..274455
Genome map
AA seq 342 aa AA seqDB search
MKLLVTGGTGFLGTHLVPRLVAAGHEVRLIGRSQPTGAAYAGTEYVPGDLKNRDAVRRAL
EGVEAVYHLAGLVSFQPKDARKMFELHVDSTRELLSDVREAGVKRVVLASTSGTIAVSKE
ERVLDERADYPITVVGQWPYYLSKIYEEKLALAYCRKHAIPLVVLNPSLLMGPGDDRLSS
TWTVVKFLNGEIPAMPGGGISFVDARDAADAFVQALTRGEVYGRHLMGVNLSMTDFFQRL
ERLSGVPAPKLKLPSKLNVLGGKLLERWAKVRGTTPALDPQEIDIGEHWFWLDASKAEAE
LGFRARDIQETLSETVRHIYGKMPPQSLPGTKGRLAELRENT
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
gtgaagctgctggtgacgggaggcacgggctttctgggcacgcacctggtgcccaggctg
gtggcggcgggccacgaggtgcggctcatcggccgctcgcagcccacgggcgcggcctac
gcgggcacggagtacgtccccggagacttgaagaaccgggacgcggtgcgccgcgcgctg
gagggcgtggaggccgtctaccacctggcggggctcgtctccttccagccgaaggacgcg
cggaagatgttcgagctgcacgtggacagcacccgcgagctgctgagcgacgtgcgcgag
gcgggcgtgaagcgcgtggtgctggcctccacctccggcaccatcgcggtgtcgaaggag
gagcgcgtcctcgacgagcgcgccgactacccgattacggtggtgggccagtggccctac
tacctgtccaaaatctacgaggagaagctggccctggcgtactgccgcaagcacgccatc
cccctggtggtgctcaaccccagcctgctgatggggccgggggatgaccggctgtcctcc
acgtggacggtggtgaagttcctcaacggcgagattccggccatgccgggtggcggcatc
tccttcgtggacgcgcgcgacgcggcggacgccttcgtccaggcgctcacccggggcgag
gtgtacggccgtcacctcatgggtgtgaatctgtccatgacggacttcttccagcggctg
gagcgcctgtccggcgtgcccgcgccgaagctgaagctgccctccaagctcaacgtgctc
ggcgggaagctgctggagcgctgggccaaggtgcgcggcaccacgccggcgttggacccg
caggaaatcgacatcggcgagcactggttctggctggacgcctccaaggcggaggccgag
ctgggcttccgcgcgcgggacatccaggagacgctctccgagacggtgcggcacatctac
gggaagatgccgccccagagcctgccgggcaccaagggccggctggcggagctgcgcgag
aacacctga

DBGET integrated database retrieval system