KEGG   Myxococcus fulvus: LILAB_01610Help
Entry
LILAB_01610       CDS       T01558                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mfu  Myxococcus fulvus
Pathway
mfu00040  Pentose and glucuronate interconversions
mfu00052  Galactose metabolism
mfu00500  Starch and sucrose metabolism
mfu00520  Amino sugar and nucleotide sugar metabolism
mfu01100  Metabolic pathways
mfu01130  Biosynthesis of antibiotics
Module
mfu_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mfu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LILAB_01610
   00052 Galactose metabolism
    LILAB_01610
   00500 Starch and sucrose metabolism
    LILAB_01610
   00520 Amino sugar and nucleotide sugar metabolism
    LILAB_01610
Enzymes [BR:mfu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     LILAB_01610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AEI62253
UniProt: F8CCJ9
Position
complement(384272..385174)
Genome map
AA seq 300 aa AA seqDB search
MASKTPKVEPLIRKCVIPAAGLGTRFLPATKAVPKEMLPIVDTPTLQYIVEEAVSAGIED
VVLINGRGKGAIEDHFDIGFEIETTLRARGKEAEADRLRAIADLVRVVSIRQKEPKGLGH
AVLCAKSVIGDEPFGVLLGDDMIDAEEPGIRQLARVYRQYNQAVIALMEVPDNETHMYGI
AAGTDLGDGVMRIDRIVEKPKKGTAPSNLAVIGRYVLPPDIFPILENQTPGVGGEIQLTD
GLATLQQSKGLLGYRFKGQRYDAGDKVGYLKANIAYALKRPDLRDGLLAYLREVVKTEKP
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atggcctccaaaaccccgaaggtagagcccctcatccgcaagtgtgtcatcccggcagcc
ggcctgggcacgcggttcctgccggcgaccaaggcggttcccaaggagatgctgcctatc
gtcgatacgccgacgctccagtacatcgtggaagaggcggtatccgcgggcatcgaggac
gtcgtcctcatcaacggccgcggcaagggcgccatcgaggaccacttcgacatcggcttc
gaaatcgagaccacgctgcgtgcgcgcggcaaggaggcggaggccgacaggctgcgcgcc
atcgcggacctggtgcgcgtggtcagcatccgccagaaggagcccaagggcctgggccac
gcggtgctgtgcgccaagagcgtcatcggcgacgagcccttcggcgtgctgctgggcgac
gacatgattgacgccgaggagccgggaatccgtcagctcgctcgcgtgtaccgccagtac
aaccaggcggtcatcgcgctgatggaagtgccggacaacgagacgcacatgtacggcatc
gccgcgggcacggacctgggcgacggcgtgatgcgcatcgaccgcatcgtggagaagccg
aagaagggcaccgcgccctccaacctcgccgtcatcgggcgctacgtgctgccgccggac
atcttccccatcctggagaaccagacgccgggggtgggcggcgaaatccagctcaccgac
ggcctggccaccctccagcagtccaaggggctgctgggctaccgcttcaagggccagcgc
tatgacgcgggcgacaaggtggggtacctgaaggccaacatcgcctatgcgctcaagcgc
ccggacctgcgggacgggctgcttgcctacctgcgtgaagtcgtgaagacggagaagccg
tga

DBGET integrated database retrieval system