KEGG   Myxococcus fulvus: LILAB_01820Help
Entry
LILAB_01820       CDS       T01558                                 

Definition
putative alkaline phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
mfu  Myxococcus fulvus
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:mfu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    LILAB_01820
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    LILAB_01820
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    LILAB_01820
Enzymes [BR:mfu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     LILAB_01820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(433078..435105)
Genome map
AA seq 675 aa AA seqDB search
MCSGDPRPDSVVLWVRAVDPDNAGGNTQVRLEVSTSEDFSSLVLDQTFTALAASDHALKV
KVTNLSARTTYYYRFSIDAGGQKHSTVTGRTRTAPAPTDTVPVKFVFASCQDYIGRYYNA
WQHLLQLDEDLDFVVFLGDYIYETTGDASFQSVDGRGVIFSEPEKALRQGTGLTAFYAAN
SLSNYRDLYKNLRKDKVIQRVHERYPFIVTWDDHEFSDDCWGDVATYTDEKTNEKQTERR
RNAEQAFFEYIPMEHGESAAGAIDINAVVSQPTRIYRDFEFGQNLKLLVTDTRTYRPDHL
IPEDAYPGKVAVPAEQLALVLPTLPEPVQAQLQSDMFAYVDIDAEELAPYKQVLTGVYVQ
QAVAAGLTAEEAATKAATWITGGQALLYVNQVLNAVNQARVAAGEDAIPAIPVDGTPRGL
AFAHMGKTGLFGIQGSRYVVVKPIFDLYAAIKYMGSAGASEGIFGNEQQAWLQESVAQAT
NAWKIIVSSISLTTMVFKLSDKADVPDPTLRQDFYFNVDQWDGFPTKKQEFLKYLRDSNV
QNALFISGDIHASFASVESGIPALTAPAISSGSIKELAGLAVIGAGFSTGSTVYRYIVAE
LDKSLKEAHPGMEFVDGDAHGFVVLEVGASEAKAAFHLIPSTEIAKDYSLRQPSELTAKF
TRRDFVIKDGTITAA
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
gtgtgctctggcgacccgcgcccggacagcgtggtgctgtgggtgcgcgcggtggacccg
gacaacgcgggcgggaacacgcaggtgcggctggaggtctccaccagcgaggacttcagc
agcctggtgctggaccagacgttcaccgcgctggcggcatccgaccatgcgctgaaggtg
aaggtcaccaacctgtccgcgcgcacgacgtactactaccgcttctccatcgacgcgggc
ggccagaagcactccacggtgacgggccgcacccgcaccgcgccggcccccacggacacc
gtgccggtgaagttcgtcttcgcgagctgccaggactacatcggccgctactacaacgcg
tggcagcacctgctgcagctcgacgaggacctggacttcgtcgtcttcctgggtgactac
atctacgagacgacgggcgacgcgtcattccagtccgtggacgggcgcggcgtcatcttc
agcgagccggagaaggcgctgcgccagggcacgggcctgacggcgttctacgcggccaac
tcgctgtccaactaccgcgacctctacaagaacctgcgcaaggacaaggtcatccagcgg
gtgcacgagcgctacccgttcatcgtcacctgggatgaccacgagttctccgacgactgc
tggggcgacgtcgcgacgtacacggacgagaagaccaacgagaagcagaccgagcgccgc
cgcaacgcggagcaggccttcttcgagtacatccccatggagcacggcgagagcgccgcg
ggcgccatcgacatcaacgccgtggtgtcccagcccacgcgcatctaccgcgacttcgag
ttcggccagaacctgaagctgctggtgacggacacgcgcacctaccgccccgaccacctc
atccccgaggacgcctacccgggcaaggtggcggtgccggccgagcagctcgccctggtg
ctcccgacgctgcccgagcccgtccaggcgcagctccagtcggacatgttcgcctacgtg
gacatcgacgcggaggagctggcgccctacaagcaggtcctcaccggcgtgtacgtgcag
caggccgtcgccgccgggctcacggcggaagaggcggccacgaaggccgccacctggatt
accggcggacaggcgctcctgtacgtcaaccaggtgctgaacgccgtcaaccaggcgcgc
gtggcggcgggcgaggatgccatcccggcgattcccgtcgacggcacgccgcgcggcctg
gccttcgcccacatgggcaagacggggctcttcggcatccagggctcgcgctacgtcgtg
gtgaagcccatcttcgacctgtacgcggccatcaagtacatgggctcggcgggggcctcc
gagggcatcttcggcaacgagcagcaggcgtggctgcaggagtcggtggcgcaggccacc
aacgcgtggaagatcattgtctcctccatctcgctcaccaccatggtgttcaagctgagc
gacaaggcggacgtcccggaccccacgctgcgccaggacttctacttcaacgtggaccag
tgggacggcttccccacgaagaagcaggagttcctcaagtacctgcgcgacagcaacgtg
cagaacgcgctgttcatctccggcgacatccacgcgtccttcgcgtccgtggagtccggc
atccccgcgctgacggcgccggccatctcctccggctccatcaaggagctggcgggcctg
gccgtcatcggagcgggcttctccaccggcagcacggtgtaccggtacatcgtggcggag
ctggacaagtcgctgaaggaggcccacccgggcatggagttcgtggacggtgacgcccac
ggcttcgtggtgctggaggtcggcgcctccgaggcgaaggcggccttccacctcatcccg
agcacggagatcgccaaggactactcgctgcgccagccctccgagctgacggcgaagttc
acccgtcgcgacttcgtcatcaaggacggcaccatcaccgccgcctga

DBGET integrated database retrieval system