KEGG   Myxococcus fulvus: LILAB_02010Help
Entry
LILAB_02010       CDS       T01558                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
mfu  Myxococcus fulvus
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mfu01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mfu00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(475376..476509)
Genome map
AA seq 377 aa AA seqDB search
MSWISTGRTALRAARRVVVKIGTNALTNATGRFNRHHFDALGQDLLWAAQGRELVVVSSG
AIALGVERLGLPSRPRDIPGKQACAAVGQSRLMQAYEEAFAARGKAVAQVLLTHEDVQER
RRYLNVKHTLERLLTAGVVPVINENDTVSVDELKFGDNDTLAGLVAGVVEADALVLLSDV
EGLYTGDPRRDADAELLATVLQVTPEVLALATGTTSGVGTGGMSTKVRAAARASESGIHC
VITSGAVPGRLRAVLEGEDVGTLFEPTGSRRSARAAWIAHALRARGTLTVDAGAREAIVT
GKRSLLPSGVRGVEGDFGRGDPVDLVGVDGAVFARGLAAYDANELRRIAGRHTADIEAVL
GYRYLDEAVHRDDLAVL
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
gtgagttggatttccacgggacgcaccgccctgcgcgccgcccggcgggtggtggtgaaa
atcggcaccaacgcgctgacgaacgccaccgggcgcttcaaccgtcatcacttcgatgcg
ctgggccaggatttgttgtgggccgcgcagggccgcgaattggtggtggtgtccagcggg
gccatcgccctgggggtggagcggctgggcctgccctcgcgccctcgcgacatcccaggc
aagcaggcgtgcgcggcggtgggacagagccggctgatgcaggcctacgaagaggccttc
gccgcgcgcgggaaggcggtggcccaggtgctgctcacccacgaggacgtgcaggagcgc
cgccgctacctcaacgtgaagcacacgctggagcggctgctgaccgcgggcgtcgtgccc
gtcatcaatgagaatgacaccgtctccgtggacgagctgaagttcggcgacaacgacacg
ctggcgggcctggtggcgggcgtggtggaggcggacgcgctcgtcctgctgtcggacgtg
gaggggctctacaccggagacccccgccgcgacgcggacgcggagctgctggccacggtg
ctgcaagtgacgcccgaggtgctggcgctggccacgggcaccaccagcggggtggggacg
ggcggcatgagcaccaaggtgcgggccgccgcgcgcgcgtccgagtccggcatccactgc
gtgatcacgtccggcgccgtgcccggccgcctgcgcgccgtgctggagggcgaggacgtg
ggcaccctcttcgagcccaccggcagccgccgcagcgcccgggccgcgtggattgcccac
gccctgcgcgcacgcgggacgctcacggtggacgcgggcgcgcgcgaggccatcgtcacc
ggcaagcgcagcctgctgcccagcggcgtgcgcggcgtggagggggacttcgggcgcgga
gaccccgtggacctggtgggcgtggacggcgccgtgttcgcccggggcctggccgcctat
gacgccaacgagctgcggcgcatcgccgggcgccacacggcggacatcgaggcggtgctg
ggctaccgctacctggacgaggcggtgcaccgcgacgacttggcggtgctgtag

DBGET integrated database retrieval system