KEGG   Myxococcus fulvus: LILAB_02315Help
Entry
LILAB_02315       CDS       T01558                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
mfu  Myxococcus fulvus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mfu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    LILAB_02315
Enzymes [BR:mfu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     LILAB_02315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
547822..549099
Genome map
AA seq 425 aa AA seqDB search
MGTHARAGYLVEQGPNSFLDREPATRALAAALNLEGRIRVADASAKRRYVYTRGRLRSVP
ASPPAFLTSDILPLGARLRVMGELFSSRAPEGTDESLAAFGRRHLGPVATRVLLDAVQTG
IYAGDVERLSVEATFPLLVKLEREHRSLILGAIHAQKAQARAKALLPPGDAPKLTGALST
FDGGLQVLIDALASSLGDAAHVGARVEGLTRVDGGWRLAVEEHGQRAELSASHVVLAVPA
HVAAELLQPLDDALAAQVSRIEYAPIAVVHLGFDAGTLPAPDGFGFLVPFEEQRRLLGAI
HASTTFPFRVEGGRVLYTCMVGGARQPDLVQRDEAELAALALEELRALAGVTARPTFTQV
FRWPRGIPQYNVGHLERMAGIDAALQRWPGLHLAGNAYKGIGLNDCIRNAARLAAALSDE
ENVRK
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
gtgggcacgcatgcgcgcgctggctacctggtggagcaggggccgaacagcttcctggac
cgggagcccgcaacgcgcgccctggcggcggcgctgaacctggaaggccggattcgcgtc
gcggacgcgtcggcgaagcgtcgctatgtctacacgcggggcagactccggtcggtgccc
gcgtcaccgcccgcgttcctgacttcggacatcctgccgctgggcgcgcggctgcgcgtc
atgggcgagctgttctccagccgcgcaccggagggcacggacgaatccctggccgcgttc
ggccgccgccacctgggccccgtggcgacgcgggtgttgttggacgcggtgcagacgggc
atctacgccggggacgtggagcggctcagcgtcgaggccaccttccccctgctggtgaag
ctggagcgcgagcaccgcagcctcatcctgggcgcaatccacgcgcagaaggcccaggcg
cgggccaaggccctgctgccccccggtgacgcgccgaagctgacgggcgcgctgagcacc
ttcgacggcggcctccaggtgctcatcgacgcgctggcctcgtccctgggagacgcggcg
cacgtgggcgcgcgggtggaggggctgacgcgcgtggacgggggctggaggctcgccgtg
gaggagcacggacagcgcgcggagctgagcgcgtcccacgtggtgctggcggtgcccgcg
cacgtcgccgccgagctgttgcagcccctggatgacgcgctggcggcgcaggtgtcccgc
atcgaatacgcgcccatcgcggtggtgcacctgggcttcgacgcggggacgctcccggcg
ccggacggcttcggcttcctggtgcccttcgaggagcagcggcggctgctgggcgccatc
cacgcgtccaccaccttccccttccgcgtcgaaggcggccgcgtgctctacacctgcatg
gtgggcggcgcgcggcagccggacctggtgcagcgggatgaagcggagctcgcggcgctg
gcgctggaggagctgcgcgccctggcgggggtgacggcccggcccaccttcacccaggtg
ttccgctggccgcgcggcatcccccagtacaacgtgggccacctggagcgcatggccggc
atcgacgcggcgctccagcgctggcccggcctgcacctggcggggaacgcgtacaagggc
attggcctcaacgactgcatccgtaacgcggcgcggctcgcggcggccctctcggacgag
gaaaacgttcggaaatag

DBGET integrated database retrieval system