KEGG   Myxococcus fulvus: LILAB_03490Help
Entry
LILAB_03490       CDS       T01558                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
mfu  Myxococcus fulvus
Pathway
mfu00010  Glycolysis / Gluconeogenesis
mfu00052  Galactose metabolism
mfu00500  Starch and sucrose metabolism
mfu00520  Amino sugar and nucleotide sugar metabolism
mfu00521  Streptomycin biosynthesis
mfu01100  Metabolic pathways
mfu01110  Biosynthesis of secondary metabolites
mfu01120  Microbial metabolism in diverse environments
mfu01130  Biosynthesis of antibiotics
mfu01200  Carbon metabolism
Module
mfu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mfu_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mfu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LILAB_03490
   00052 Galactose metabolism
    LILAB_03490
   00500 Starch and sucrose metabolism
    LILAB_03490
   00520 Amino sugar and nucleotide sugar metabolism
    LILAB_03490
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LILAB_03490
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    LILAB_03490
Enzymes [BR:mfu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     LILAB_03490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG Hydant_A_N FGGY_N
Motif
Other DBs
NCBI-ProteinID: AEI62623
UniProt: F8CJB0
Position
complement(825660..826682)
Genome map
AA seq 340 aa AA seqDB search
MREANAVGSRRKTAARDTPECWGGVDLGGTKIEAVVVDRAGTVLGKLRQPTPADGEPGDV
VRAIHDTLEGAAHAAGLTARQLLGVGVGAPGAVNANEGTLAHVSNVGRGWTAPYPVAGEL
GARVGCPVALGNDVQVAVAAEYRLGAGRPYRSLLGVWWGTGVGGGLVLDGVPWRGRGAAG
EVGHMVVKPGGARCGCGRRGCLEAYAGRASMERRARTAVRHGEATVLFDVMRKKGRTRLT
SSVWARALAHEDALATWLIGRAVRMLGVGLASAINLLDVEAVVLGGGLGTRLGPEFAGRI
HEAMRPHIFVPERQPPVRVAELGELSGAIGAALLAQPPLG
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgcgggaggcgaacgcggtgggctcgcggcggaagacggcggcgcgtgacaccccggag
tgctggggcggggtcgacctgggcgggacgaagatcgaggccgtggtggtggaccgcgcg
ggcaccgtcctggggaagctgcgccagcccacgcccgccgacggcgagcccggcgacgtg
gtgcgcgccatccatgacaccctggagggggcggcgcacgccgcgggcctgacggcgcgc
cagctcctgggcgtgggcgtgggcgcgcccggcgcggtgaacgccaacgagggcaccctg
gcgcacgtcagcaacgtgggccgcggctggacggcgccgtacccggtggcgggggagctg
ggcgcgcgcgtgggctgccccgtggcgctgggcaacgacgtgcaggtggcggtggcggcc
gagtaccggctgggcgcgggccggccctaccgctccctgctgggcgtctggtgggggacg
ggcgtgggcggaggcctggtgctggacggcgtgccgtggcgcggccggggcgcggcgggc
gaggtgggccacatggtggtgaagccgggaggcgcccgctgcggctgtggccggcgtggc
tgcctggaggcctacgcgggccgcgcgtccatggagcgccgcgcccgcacggccgtgcgc
cacggcgaggcgaccgtcctcttcgacgtgatgcggaagaagggccgcacccggttgacc
agcagcgtctgggcccgggcgctggcgcacgaggacgcgctggccacgtggctcatcggc
cgcgcggtgcggatgctgggcgtggggctcgcctccgccatcaacctgctggacgtggag
gcggtggtgctgggcggcggcctgggcacgcggctgggccccgagttcgccggccgcatc
catgaggccatgcgcccgcacatcttcgtccctgaacgccagccgcccgtgcgcgtcgct
gaactgggagaactttccggtgccattggcgccgcgctgctggcccagccgccgctgggc
tga

DBGET integrated database retrieval system