KEGG   Myxococcus fulvus: LILAB_03490Help
Entry
LILAB_03490       CDS       T01558                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
mfu  Myxococcus fulvus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mfu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LILAB_03490
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LILAB_03490
   00052 Galactose metabolism
    LILAB_03490
   00500 Starch and sucrose metabolism
    LILAB_03490
   00520 Amino sugar and nucleotide sugar metabolism
    LILAB_03490
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LILAB_03490
   00524 Butirosin and neomycin biosynthesis
    LILAB_03490
Enzymes [BR:mfu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     LILAB_03490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(825660..826682)
Genome map
AA seq 340 aa AA seqDB search
MREANAVGSRRKTAARDTPECWGGVDLGGTKIEAVVVDRAGTVLGKLRQPTPADGEPGDV
VRAIHDTLEGAAHAAGLTARQLLGVGVGAPGAVNANEGTLAHVSNVGRGWTAPYPVAGEL
GARVGCPVALGNDVQVAVAAEYRLGAGRPYRSLLGVWWGTGVGGGLVLDGVPWRGRGAAG
EVGHMVVKPGGARCGCGRRGCLEAYAGRASMERRARTAVRHGEATVLFDVMRKKGRTRLT
SSVWARALAHEDALATWLIGRAVRMLGVGLASAINLLDVEAVVLGGGLGTRLGPEFAGRI
HEAMRPHIFVPERQPPVRVAELGELSGAIGAALLAQPPLG
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgcgggaggcgaacgcggtgggctcgcggcggaagacggcggcgcgtgacaccccggag
tgctggggcggggtcgacctgggcgggacgaagatcgaggccgtggtggtggaccgcgcg
ggcaccgtcctggggaagctgcgccagcccacgcccgccgacggcgagcccggcgacgtg
gtgcgcgccatccatgacaccctggagggggcggcgcacgccgcgggcctgacggcgcgc
cagctcctgggcgtgggcgtgggcgcgcccggcgcggtgaacgccaacgagggcaccctg
gcgcacgtcagcaacgtgggccgcggctggacggcgccgtacccggtggcgggggagctg
ggcgcgcgcgtgggctgccccgtggcgctgggcaacgacgtgcaggtggcggtggcggcc
gagtaccggctgggcgcgggccggccctaccgctccctgctgggcgtctggtgggggacg
ggcgtgggcggaggcctggtgctggacggcgtgccgtggcgcggccggggcgcggcgggc
gaggtgggccacatggtggtgaagccgggaggcgcccgctgcggctgtggccggcgtggc
tgcctggaggcctacgcgggccgcgcgtccatggagcgccgcgcccgcacggccgtgcgc
cacggcgaggcgaccgtcctcttcgacgtgatgcggaagaagggccgcacccggttgacc
agcagcgtctgggcccgggcgctggcgcacgaggacgcgctggccacgtggctcatcggc
cgcgcggtgcggatgctgggcgtggggctcgcctccgccatcaacctgctggacgtggag
gcggtggtgctgggcggcggcctgggcacgcggctgggccccgagttcgccggccgcatc
catgaggccatgcgcccgcacatcttcgtccctgaacgccagccgcccgtgcgcgtcgct
gaactgggagaactttccggtgccattggcgccgcgctgctggcccagccgccgctgggc
tga

DBGET integrated database retrieval system