KEGG   Myxococcus fulvus: LILAB_04645Help
Entry
LILAB_04645       CDS       T01558                                 

Definition
(GenBank) formaldehyde dehydrogenase, glutathione-independent
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
mfu  Myxococcus fulvus
Pathway
mfu00625  Chloroalkane and chloroalkene degradation
mfu00680  Methane metabolism
mfu01100  Metabolic pathways
mfu01120  Microbial metabolism in diverse environments
mfu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mfu00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    LILAB_04645
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LILAB_04645
Enzymes [BR:mfu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     LILAB_04645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C FAD_binding_3 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AEI62850
UniProt: F8CM82
Position
complement(1113743..1114945)
Genome map
AA seq 400 aa AA seqDB search
MPSNRGVVYLGPGKVEVQSIDSPRLANPKGKPIEHGVILKVVSTNICGSDQHMVRGRTTA
SKGLVLGHEITGEIIEKGKDVEFLDVGDLVTVPFNVACGRCRTCREQQTGVCLNVNEGRA
GGAYGYVDMGGWVGGQAEYVLVPYADFNLIRFPDKAQAMEKILDLTMLSDILPTGFHGAV
SAGVGVGSTVYIAGAGPVGLAAAASARILGAAVVMVGDMNKERLAHAKSVGFEPIDLTQS
DKLEELIAAVVGVPEVDASVDAVGFEARGHGARHSTEAPATVLNSLMAVTRAAGAIGIPG
LYVTEDPGSQDEAAQHGNLRMRFGLGWAKSLRFSTGQTPVLRYNRQLMQAILHGRLPIAK
VVNATVISLDDAPRGYHEFDTGVARKFVIDPHGMLKQKAA
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgcccagcaatcgcggcgtcgtgtatctcggtcccggcaaggtggaggtgcagtccatt
gactcccccaggctggccaaccccaaggggaaacccatcgagcacggcgtcatcctgaag
gtggtctccaccaacatctgcggctcggaccagcacatggtgcgcggcaggacgacggcg
tccaaggggctggtgctcgggcacgaaatcaccggcgagatcatcgagaagggaaaggac
gtcgagttcctggacgtgggggacctcgtcacggtgcccttcaacgtggcctgtggccgc
tgccgcacgtgccgggagcagcagacgggcgtgtgcctcaacgtcaacgagggccgcgcg
ggcggcgcctacggctacgtggacatgggcggctgggtgggcggccaggccgaatatgtc
ctggtgccctacgcggacttcaacctcatccgcttccccgacaaggcgcaggcgatggag
aagattctcgacctgaccatgctgtcggacatcctgcccacgggcttccacggcgccgtc
agcgcgggcgtgggggtgggctccaccgtgtacatcgcgggcgcggggccggtggggctc
gcggcggcggcgtccgcgcggattttgggcgcggcggtggtgatggtgggggacatgaac
aaggagcggttggcccacgcgaagtccgtgggcttcgagcccattgacctcacgcagagc
gacaagctggaggagttgattgccgccgtcgtgggcgtgcccgaggtggatgcctccgtg
gacgcggtgggcttcgaggcgcgcggccacggcgcgcggcattcgacggaggcgccggcc
acggtgctcaactcgctgatggcggtgacgcgggccgcgggcgccattggcatcccgggg
ctgtatgtgacggaggacccgggctcccaggacgaggcggcgcagcacggcaacctgcgc
atgcgcttcggcctgggctgggccaagtcacttcgcttctccacggggcagacgccggtg
ctgcgctacaaccgccagctcatgcaggccatcctccacggccgactgcccatcgcgaag
gtcgtgaacgccaccgtcatctcgctcgacgacgcgccgcgcgggtaccacgagttcgac
acgggcgtggcgcgcaagttcgtcatcgacccgcacgggatgttgaagcagaaggcggcc
tga

DBGET integrated database retrieval system