KEGG   Myxococcus fulvus: LILAB_04645Help
Entry
LILAB_04645       CDS       T01558                                 

Definition
formaldehyde dehydrogenase, glutathione-independent
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
mfu  Myxococcus fulvus
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:mfu01200]
Metabolism; Energy metabolism; Methane metabolism [PATH:mfu00680]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:mfu00625]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1113743..1114945)
Genome map
AA seq 400 aa AA seqDB search
MPSNRGVVYLGPGKVEVQSIDSPRLANPKGKPIEHGVILKVVSTNICGSDQHMVRGRTTA
SKGLVLGHEITGEIIEKGKDVEFLDVGDLVTVPFNVACGRCRTCREQQTGVCLNVNEGRA
GGAYGYVDMGGWVGGQAEYVLVPYADFNLIRFPDKAQAMEKILDLTMLSDILPTGFHGAV
SAGVGVGSTVYIAGAGPVGLAAAASARILGAAVVMVGDMNKERLAHAKSVGFEPIDLTQS
DKLEELIAAVVGVPEVDASVDAVGFEARGHGARHSTEAPATVLNSLMAVTRAAGAIGIPG
LYVTEDPGSQDEAAQHGNLRMRFGLGWAKSLRFSTGQTPVLRYNRQLMQAILHGRLPIAK
VVNATVISLDDAPRGYHEFDTGVARKFVIDPHGMLKQKAA
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgcccagcaatcgcggcgtcgtgtatctcggtcccggcaaggtggaggtgcagtccatt
gactcccccaggctggccaaccccaaggggaaacccatcgagcacggcgtcatcctgaag
gtggtctccaccaacatctgcggctcggaccagcacatggtgcgcggcaggacgacggcg
tccaaggggctggtgctcgggcacgaaatcaccggcgagatcatcgagaagggaaaggac
gtcgagttcctggacgtgggggacctcgtcacggtgcccttcaacgtggcctgtggccgc
tgccgcacgtgccgggagcagcagacgggcgtgtgcctcaacgtcaacgagggccgcgcg
ggcggcgcctacggctacgtggacatgggcggctgggtgggcggccaggccgaatatgtc
ctggtgccctacgcggacttcaacctcatccgcttccccgacaaggcgcaggcgatggag
aagattctcgacctgaccatgctgtcggacatcctgcccacgggcttccacggcgccgtc
agcgcgggcgtgggggtgggctccaccgtgtacatcgcgggcgcggggccggtggggctc
gcggcggcggcgtccgcgcggattttgggcgcggcggtggtgatggtgggggacatgaac
aaggagcggttggcccacgcgaagtccgtgggcttcgagcccattgacctcacgcagagc
gacaagctggaggagttgattgccgccgtcgtgggcgtgcccgaggtggatgcctccgtg
gacgcggtgggcttcgaggcgcgcggccacggcgcgcggcattcgacggaggcgccggcc
acggtgctcaactcgctgatggcggtgacgcgggccgcgggcgccattggcatcccgggg
ctgtatgtgacggaggacccgggctcccaggacgaggcggcgcagcacggcaacctgcgc
atgcgcttcggcctgggctgggccaagtcacttcgcttctccacggggcagacgccggtg
ctgcgctacaaccgccagctcatgcaggccatcctccacggccgactgcccatcgcgaag
gtcgtgaacgccaccgtcatctcgctcgacgacgcgccgcgcgggtaccacgagttcgac
acgggcgtggcgcgcaagttcgtcatcgacccgcacgggatgttgaagcagaaggcggcc
tga

DBGET integrated database retrieval system