KEGG   Myxococcus fulvus: LILAB_05210Help
Entry
LILAB_05210       CDS       T01558                                 

Definition
protein-glutamate methylesterase domain-containing protein
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
mfu  Myxococcus fulvus
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:mfu02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:mfu02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1248749..1249291)
Genome map
AA seq 180 aa AA seqDB search
MLVVGAPRSAAADVESVLALLPPHLAVPVVLALHRGPLDALAAPLGRRCALPVVEPDDKD
LLVPGAVYLAPAGYHLLVDRGSVALSVEPPEHGQRPGLDALFESAADSHGPRAAGLLFAG
HEDGVAGLHALQARGGRVAVVGPHPAGGEGEDGEMEQLTLGSVGGWLARLAYVPRSKVLP
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
ttgttggtggtgggggcgccgcgctcggcggcggcggacgtggagtcggtcctggcgctc
ttgccgccgcacctggccgtgccggtggtgctggcgctgcaccgggggccgctggacgcg
ctggccgcgccgctgggccgccgctgcgcgctgccggtggtggagccggatgacaaggac
ctgctggtgcccggcgcggtgtacctggcgcccgcgggttatcacctgctggtggaccgg
ggcagcgtggccctgtccgtggagccgccggagcatgggcagcggccgggcctggacgcg
ctctttgaatccgccgcggacagccatgggccccgggccgcggggctgctgttcgcgggg
cacgaggacggcgtcgcggggctgcatgcgctccaggcgcgcggtggccgggtggccgtg
gtggggccgcacccggcgggaggcgagggagaggatggcgagatggagcaactgacgttg
gggtccgtgggagggtggctcgcgcggctggcctacgtgccgcgttccaaggtgctgcct
tga

DBGET integrated database retrieval system