KEGG   Myxococcus fulvus: LILAB_06415Help
Entry
LILAB_06415       CDS       T01558                                 

Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
mfu  Myxococcus fulvus
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mfu00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    LILAB_06415
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LILAB_06415
  Lipid metabolism
   00071 Fatty acid degradation
    LILAB_06415
  Amino acid metabolism
   00350 Tyrosine metabolism
    LILAB_06415
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LILAB_06415
   00626 Naphthalene degradation
    LILAB_06415
Enzymes [BR:mfu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LILAB_06415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1537149..1538159)
Genome map
AA seq 336 aa AA seqDB search
MDGGMRAMVLRETGHPLREVRLPIPRPGLEELLLRVRACAVCRTDLHVVDGELPEPKLPL
VPGHEIVATVEAAGERATAIPVGTRVGVPWLGWSCGRCRFCLNGQENLCEQARFTGYQLD
GGYAEYTVAHQRFCFPLPPEYSDVHAAPLMCAGLIGFRGLRLAGAERRLLGLYGFGAAAH
LLIQVIRHQGRRAFAFTRPGDVEGQRFARELGAEWAGGSDTPPPERLDAAILFAPVGALV
PTALQAVDKAGVVVCGGIHMSDIPSFPYALLWEERVVRSVANLTRADAVDFLALAPRVPV
RTQVQTFPLSAANEALTALRRGQVRGAAVLDLAAPV
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atggacggcggcatgcgcgcgatggtgctgcgggagacagggcacccgctgcgggaggtg
cggctgcccatcccccgcccgggtctggaggagctgctgctccgcgtgcgcgcctgcgcc
gtctgccgcaccgacctgcacgtcgtggacggtgagctgcccgagcccaagctgccgctg
gtgcccggccacgaaatcgtggccaccgtggaggcggcgggcgagcgggcgacggccatc
cccgtgggcacgcgagtcggcgtcccctggctcggctggagctgtggccgctgccgcttc
tgtctgaacggccaggagaacctctgcgagcaggcgcgcttcaccggctaccaactcgat
gggggctacgcggagtatacggtggcgcaccagcgcttctgcttcccgttgccgcccgag
tactccgacgtccacgccgcgccattgatgtgcgccgggctcatcggcttccgcggcctc
cggctggcgggcgcggagcggcgcttgttggggctctatggttttggcgcggcggcgcac
ctgctcatccaggtcatccgccaccagggccgccgcgccttcgccttcacccgccccggg
gacgtggagggccagcggttcgcgcgggagctgggcgcggagtgggcggggggctcggac
accccgccaccggagcgtctggacgcggccatcctcttcgcgccggtgggcgcactggtg
cccaccgcgctccaggcggtggacaaggcgggcgtggtggtgtgcggcggcatccacatg
agcgacatcccctccttcccctatgcgctgctgtgggaggagcgggtggtgcgctcggtg
gcgaacctcacccgcgcggacgcggtggacttcctcgcgctcgcgccccgggtgccggtg
cgcacgcaggtgcagaccttccccctgtccgccgccaacgaagcgctcaccgcgctgcga
cgcggccaggtgcgcggcgcggccgtgctcgacctcgcggcgccggtgtga

DBGET integrated database retrieval system