KEGG   Myxococcus fulvus: LILAB_06985Help
Entry
LILAB_06985       CDS       T01558                                 

Definition
fatty acid desaturase family protein
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
mfu  Myxococcus fulvus
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mfu00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    LILAB_06985
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    LILAB_06985
Enzymes [BR:mfu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     LILAB_06985
Lipid biosynthesis proteins [BR:mfu01004]
 Desaturase
  First
   LILAB_06985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1665384..1666319
Genome map
AA seq 311 aa AA seqDB search
MTDTGSTRWGTATLDGGRVLRWGLLHAGALVGGACFFSWSAVAVFAGLTAVTMCLGVSVG
LHRGLIHRAFRAPAPVEHALALLGTLAGLGGPLGMSRMHDLRDFHQNQPEADCPPYFGYR
EGFARAMAYALFHTWHPRDGAAPAAPHLEEDACFRRLERAGLWLQLPLALALYALGGASW
VAWGVLVRLALTQDGFWCVHYVSHVEGDQPYELPGRAEQGRNAGWLALLSMGEAWHNTHH
AYPASAQMGRGWRQPDPGWWAVRALAALRLVHDVKTLAHLPLRPDTRVRVPEPRDAPSTG
ALCLKRAWGRT
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgacggacacgggcagcacgcggtgggggacggcgacgctggacggaggcagggtgctg
cgctggggcctcctgcacgcgggggcgctggtgggaggcgcctgcttcttctcgtggagc
gcggtggcggtgttcgccgggctgacggcggtgacgatgtgcctgggcgtgtcggtgggc
ctgcaccgggggctcatccaccgggccttccgcgccccggcgcccgtggagcacgcgctg
gcgctgctcggcacgctggcgggcctgggcggtcccctgggcatgagccggatgcacgac
ctgcgcgacttccaccagaaccagccggaggcggactgcccgccctacttcggctaccgc
gagggcttcgcgcgcgccatggcctacgccctcttccacacctggcacccgcgcgacggc
gccgcgcccgcggccccgcacctcgaggaggacgcgtgcttccggcggctggagcgcgcg
ggcctgtggctccagctcccgctcgccctggccttgtatgccctgggcggcgcgagctgg
gtggcctggggcgtcctggtgcggctggcgctcacacaggacggcttctggtgcgtccac
tacgtgagtcatgtggaaggcgaccagccctacgagctgccgggccgcgccgagcagggg
cgcaacgccggctggctggcgctgctgagcatgggcgaggcgtggcacaacacccaccac
gcctacccggcctcggcgcagatggggcgcggctggcggcaacccgacccaggctggtgg
gcggtgcgcgcgctggccgcgctgcggctggtgcacgacgtgaagacgctggcccacctg
ccgctgcgccctgacacccgggtgcgtgtcccggagccccgtgacgccccgagcaccggc
gccctgtgcctgaaacgcgcctggggccgcacctga

DBGET integrated database retrieval system