KEGG   Myxococcus fulvus: LILAB_07165Help
Entry
LILAB_07165       CDS       T01558                                 

Definition
putative asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
mfu  Myxococcus fulvus
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:mfu00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1712577..1713803
Genome map
AA seq 408 aa AA seqDB search
MWRLNPTGLAPEAVAAFLCHATRPGESVFRGVRRLPGALPRVRRGTEALADEDTLAERLV
AALADRVGRHLAAGAVDVSLSGGVDSATLCALAARQAPGRVRAWTMDVHFADATERRNAR
TVAREAGVELVDVAIPDAVLPELFEPAVLSQETAILNARAVASFAFYAEARRQGAVTLLS
GAGADEVLMGNPEALVGATARVREDRRLAREVLRPGPVDNLGVDQRARLLPWEAGLAPGD
EDHPEEVRYAAWVLWELVLPPELRSASTQGVKVHTPYLDAGFADAALALPRDVLARHDAG
KWLFRHAVRSLVPDAVRLARKTPRYAQTALSSPVRARWLELYREWLTPDRLGPLEVVDVG
AARALLERSARLAPDASEAGGVDRLLMRLCSLAMLHAHASARPPCPES
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
gtgtggcggctcaatcccacggggctggccccggaggccgtcgccgccttcctgtgccat
gcgacgcggcccggggagagcgtgttccggggcgtgcgccggttgcccggggcgttgcct
cgcgtgcggcgcggcacggaggcgctcgcggatgaagacacgctggcggagcggctcgtg
gccgcgctggcggaccgcgtgggccggcacctggcggcgggcgcggtggacgtcagcctg
agcggcggcgtggacagcgccacgttgtgcgccctggccgcgcggcaggcccctggacgc
gtccgtgcctggaccatggacgtccacttcgcggatgccacggagcggcggaatgcccgg
acggtggcgcgtgaggccggggtcgagctggtggacgtggccatcccggacgcggtgctc
cccgagctgttcgagcccgcggtgctgagccaggagacggccatcctcaacgcccgcgcc
gtggcgagcttcgccttctacgcggaggccaggcggcagggcgctgtcaccctgctgagc
ggcgccggcgcggacgaggtgctcatgggcaacccggaggcgctcgtgggcgcgacggcc
cgggtgagggaggaccggcgcctcgctcgcgaggtgctgcgcccagggcctgtggacaac
ttgggggtggatcagcgggcgcggctgctcccgtgggaagcggggctggcgcccggtgac
gaggatcatccagaagaggtccgttacgcggcctgggtcctctgggagctggtcctgcct
cccgagctccgcagcgcgagcacacagggggtgaaggtgcacacgccctacctggacgca
ggcttcgcggacgcggcgctggcgcttccccgggacgtgctggcccgtcacgacgcgggc
aagtggctcttccggcacgcggtgcgctcgctggtgcccgacgcggtccggctcgctcgg
aagacgccgcgttacgcgcagacggcgctctccagtcccgtccgcgcgcgctggttggag
ctgtaccgggaatggctcacgcctgaccggctggggccgctggaggtcgtcgacgtgggc
gcggcccgggcgctgctggagcgctccgcgcgtctggcgcctgacgcttccgaggcgggg
ggcgtggaccggctgttgatgcggctgtgctcgctcgccatgctccacgcccacgccagc
gctcgccccccatgtcccgaatcctga

DBGET integrated database retrieval system