KEGG   Myxococcus fulvus: LILAB_11490Help
Entry
LILAB_11490       CDS       T01558                                 

Definition
fatty oxidation complex subunit alpha
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
mfu  Myxococcus fulvus
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mfu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LILAB_11490
   01212 Fatty acid metabolism
    LILAB_11490
  Carbohydrate metabolism
   00640 Propanoate metabolism
    LILAB_11490
   00650 Butanoate metabolism
    LILAB_11490
  Lipid metabolism
   00071 Fatty acid degradation
    LILAB_11490
   01040 Biosynthesis of unsaturated fatty acids
    LILAB_11490
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LILAB_11490
   00310 Lysine degradation
    LILAB_11490
   00380 Tryptophan metabolism
    LILAB_11490
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LILAB_11490
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    LILAB_11490
   00281 Geraniol degradation
    LILAB_11490
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    LILAB_11490
Enzymes [BR:mfu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     LILAB_11490
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     LILAB_11490
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     LILAB_11490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2730098..2732275
Genome map
AA seq 725 aa AA seqDB search
MSEQSTIRWDQDADGIVVLTLDDPNQSANTMNAAYLKSMRATVDRLVKEKDSIAGVVLTS
AKKTFFAGGDLKDLLKVRKEDARQSFELGQEIKAQLRALETLGKPVVAAINGAALGGGLE
IALACHHRIVADVKGAQVGLPEVTLGLLPGGGGVVRTVRMLGIVDALMKVLLQGQRYRPQ
EAKEVGLVHEVVDSVDALLPAAKAWVKAHPTAQQPWDVKGYKIPGGTPSHPGLAANLPAF
PANLRKQLKGANMPAPRAIMAVAVESTQVDVDTAFTVESRYFTELVTGQVAKNMIQAFFF
DMQHINSGGGRPKDYPRYTAKKVGVLGAGMMGAGIAYVCAKAGIDVVLKDVSLASAEKGK
QYSVKLVEKAVQRGKSTKEKGDALLARILPTDKAADLKGCDLVIEAVFEDVKLKHQVFQE
VQDVVAPDAVLGSNTSTLPITVLAEGVKRTEDFVGMHFFSPVDKMPLLELIAGKKTSDAT
LAKAIDIAAQIGKTPIVVNDSRGFFTSRVIGTFLNEAIAMVGEGIAPASIEQAGLQAGYP
AAPLSLMDELTLTLPRKIRQETKAAALAEGKPWAEHGSYAVVDALIDQHQRKGRSTGGGF
YDYEDGKRAGLWKGLAQHFTKPGHTIPFEDMKDRMLFAEAIDTVRCFDEGVLRSAADANI
GSILGIGFPAWTGGVAQFINGYEGRTGNGPRGFVARARELAQRYGAHFEPPASLVEKAEK
GELLK
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagcagagcaccatccgctgggaccaggacgccgacggcatcgtcgtcttgacg
ttggatgacccgaaccagtccgcgaacaccatgaacgccgcgtacttgaagtccatgcgc
gcgacggtggaccggctggtcaaggagaaggacagcatcgcaggcgtcgtcctcacctcc
gcgaagaagaccttcttcgccggcggtgacttgaaggacctgctgaaggtccgcaaggag
gacgcgcggcagtccttcgagctgggacaggaaatcaaggcgcagctccgcgcgctggag
acgctgggcaagccggtggtcgcggccatcaacggcgcggcgctgggcggcgggctggag
attgccctggcgtgccaccaccgcatcgtggcggacgtgaagggcgcccaggtgggcctg
ccggaggtgacgctgggcctgctgcccggcggcggcggcgtggtgcgcacggtgcgcatg
ctgggcatcgtggacgcgctgatgaaggtgctgctccagggccagcgctaccgcccgcag
gaggccaaggaggtgggcctggtgcatgaggtggtggactccgtggacgcgctgctgccc
gcggccaaggcgtgggtgaaggcgcatcccaccgcgcagcagccctgggacgtgaagggc
tacaagattccgggcggcacgccgtcgcaccccggcctcgcggcgaacctgccggcgttc
cccgccaacctgcgcaagcagctcaagggcgcgaacatgccggcgcctcgcgccatcatg
gcggtggcggtggagagcacccaggtggacgtggacaccgcgttcaccgtggagtcgcgc
tacttcaccgaactcgtcacggggcaggtcgcgaagaacatgattcaggcgttcttcttc
gacatgcagcacatcaactcgggtggcggccgtcccaaggactacccgcggtacaccgcg
aagaaggtgggcgtgctgggcgcggggatgatgggcgcgggcatcgcctacgtctgcgcc
aaggccggcatcgacgtggtgctcaaggacgtgagcctggcgtcggcggagaagggcaag
cagtactccgtgaagctggtggagaaggccgtccagcggggcaagtccaccaaggagaag
ggggacgcgctgctggcgcgcatcctccccacggacaaggccgccgacctgaaggggtgt
gacctggtcatcgaggccgtgttcgaggacgtgaagctcaagcaccaggtcttccaggag
gtgcaggacgtcgtcgcgccggacgcggtgctcgggtccaacacgtccacgctgcccatc
accgtgctggccgagggcgtgaagcgcacggaggacttcgtgggcatgcacttcttctcc
cccgtggacaagatgccgctgctggagctcatcgcggggaagaagacgagcgacgccacg
ctcgcgaaggccatcgacatcgcggcgcagattgggaagacgcccatcgtcgtcaacgac
agccggggcttcttcaccagccgcgtcattggcaccttcctcaacgaggccatcgccatg
gtgggcgagggcatcgcgcccgcctccatcgagcaggcgggcctccaggcgggctacccc
gccgccccgctcagcttgatggacgagctcacgctgacgctgccgcggaagattcgccag
gagacgaaggccgcggccctggcggagggcaagccctgggcggagcacggcagctacgcc
gtggtggacgcgctcatcgaccagcaccagcgcaagggccgctccacgggcggcggcttc
tacgactacgaggatggcaagcgcgcggggctgtggaagggcctggcgcagcacttcacc
aagcccggccacaccatccccttcgaggacatgaaggaccggatgctgttcgccgaggcc
atcgacacggtgcgctgcttcgacgaaggcgtgctgcgctccgccgcggacgccaacatc
ggctccatcctgggcatcggcttcccggcgtggacgggcggcgtggcccagttcatcaac
ggctacgaggggcggaccggcaacgggccgcggggcttcgtggcgcgcgcgcgcgagctc
gcgcagcgctacggggcgcacttcgagccgccggcctcgctcgtggagaaggccgaaaag
ggcgagctcttgaagtag

DBGET integrated database retrieval system