KEGG   Myxococcus fulvus: LILAB_12370Help
Entry
LILAB_12370       CDS       T01558                                 

Definition
cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
mfu  Myxococcus fulvus
Brite
Enzymes [BR:mfu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     LILAB_12370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2927156..2928382
Genome map
AA seq 408 aa AA seqDB search
MSLPADLPPGVSQVLWKLSVPADLAPTPERVLLGEKLFNDQRLSVDNTVSCSTCHDARFG
FTDAKPVSEGVKGQKVTRNSPTLLNALFNASQFWDGRASTLEDQAKLPILNPREMGMPDE
AAVVAKVKAIPEYVRDFQNVFGREVNFDDLAAAIAAFERTLYSGDAKFDRFITGDARAFT
AAERRGWALFNGKARCNTCHAGNVVSPLFSDQKFHNIGIAAHKQDFVKLAREALKVVRTG
DAQQIDELALQTRFSELGRFLVTKQENDVGAFKTPTLRNIAITGPYMHDGTLTTLWDVMD
HYNKGGVPNPYLDGGMQRLGLTEAEIDDVVAFLFTLTDARFAKYAAKEQARQRRLKHKRP
ERDTAVAMGKSGNLGDLAPNPDLSVKNPADIGVYGTETLVKPASTSRP
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
gtgtccctgcccgccgacctgccgccgggcgtgtcccaggtcctgtggaagctctccgtc
cccgccgacctcgcgcccacgccggagcgggtgctgctgggggagaagctcttcaacgac
cagcgcctgtcggtggacaacaccgtgtcctgctccacctgccatgacgcgcgcttcggc
ttcacggacgcgaagccggtatcggaaggcgtgaagggacagaaggtgacgcgcaacagc
cccaccctcctcaacgcgctcttcaatgcctcccagttctgggacggccgcgcgtccacg
ctggaggaccaggcgaagctgcccatcctcaacccgcgggagatgggcatgcccgacgag
gcggcggtggtggccaaggtgaaggccatcccggagtacgtgcgggacttccagaacgtc
tttggccgcgaggtgaacttcgacgacctggcggccgccatcgccgccttcgagcgcacc
ctctactccggcgacgcgaagttcgaccgcttcatcaccggggacgccagggccttcacc
gccgcggagcgccggggctgggcgctgttcaacggcaaggcccgctgcaacacctgccac
gcgggcaacgtggtgtcgccgctgttcagcgaccagaagttccacaacatcggcatcgcg
gcgcacaagcaggacttcgtgaagctggcccgcgaggccctgaaggtggtccgcaccggc
gacgcgcagcagattgacgagctggcgcttcagacgcgcttctccgagctgggccgcttc
ctggtgacgaagcaggagaacgacgtgggcgccttcaagacgcccaccctgcgcaacatc
gccatcaccggcccgtacatgcacgacggcaccctgacgacgctgtgggacgtcatggac
cactacaacaagggcggcgtgcccaacccgtacctggacggcggcatgcagcggctggga
ctgacggaggcggaaatcgacgacgtggtggccttcctcttcaccctcaccgacgctcgg
ttcgcgaagtacgcggcgaaggagcaggcccgccagcgccgcttgaagcacaagcgcccg
gagcgcgacaccgcggtggccatggggaagtcggggaacctgggagacctggcccccaac
ccggacctgtcggtgaaaaacccggcggacatcggtgtgtacggcaccgagacgctcgtg
aagcccgcctcgacgtccaggccctag

DBGET integrated database retrieval system