KEGG   Myxococcus fulvus: LILAB_12580Help
Entry
LILAB_12580       CDS       T01558                                 

Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
mfu  Myxococcus fulvus
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:mfu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LILAB_12580
  Amino acid metabolism
   00300 Lysine biosynthesis
    LILAB_12580
Enzymes [BR:mfu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     LILAB_12580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2974519..2975607
Genome map
AA seq 362 aa AA seqDB search
MASIDLATRLARTTLELCRISSPITQEGPIADHVERWALQHFKPEEVFRVGHTLLLGRLE
DPRPTVALIGHLDTVPAHPSDAGREARIEGERVFGLGASDMKGGLAVMMALAEDLRRDTL
PVNLAFLFYEREEGAYAESGLIPLFDKRPDLAKVKFGIAMEPTDSVVQVGCVGSMQVTVR
FMGRSAHSARPWQGENAIHKAGPLLAELLGRQRVEVNVAGFPFYEVINATLAKGGRARNV
IPEAFELNLNYRFAPGKSIAQAKADVHALVAGRAEVEFTDASPSGPVVAGNPLFQKLMAL
TGLPAASKQAWTDVARFGEWGVDAINFGPGETAQAHQANESAPIPPLADAYEKLAAFLKG
AG
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggcttccatcgacctcgccacgcggctggctcgcaccacgctcgagctgtgccgcatc
tccagccccatcacccaggaggggcccatcgccgaccacgtcgagcgctgggcgctccag
cacttcaagccggaggaggtgttccgggtcgggcacacgttgctgctcgggcggctggag
gacccgcgccccacggtggccctcatcgggcacctggacacggtgcccgcgcaccccagc
gacgcgggccgcgaggcgcgcatcgagggcgagcgcgtcttcgggctgggcgcctcggac
atgaagggcgggctggcggtgatgatggcgctcgcggaggacctgcgccgggacaccctg
ccggtgaacctggccttcctcttctacgagcgcgaggagggcgcctacgccgagagcggc
ctcatcccgctgttcgacaagcggcccgacctggcgaaggtgaagttcggcatcgccatg
gagcccacggacagcgtggtgcaggtgggctgcgtcggctccatgcaggtgacggtgcgc
ttcatgggccgcagcgcgcactcggcgcggccgtggcagggggagaacgccatccacaag
gcgggcccgctcctcgcggagttgctcgggcgccagcgcgtggaggtcaacgtcgccggc
ttccccttctacgaggtcatcaacgccacgctcgccaagggcggccgcgcgcgcaacgtc
atccccgaggccttcgagctcaacctcaactaccgcttcgcgccgggcaagagcatcgcg
caggccaaggcggacgtgcacgcgctcgtcgccgggcgcgccgaggtggagttcaccgac
gcgtcgcccagcgggcccgtggtggcgggcaacccgctgttccagaagctgatggccctc
accggcctgcccgcggcctccaagcaggcgtggacggacgtggcccgcttcggcgagtgg
ggcgtggacgccatcaacttcgggcccggtgagacggcccaggcgcatcaggcgaacgag
agcgcgcccatcccgccgctcgcggacgcgtacgagaagctcgccgcgttcctcaagggc
gcgggctga

DBGET integrated database retrieval system