KEGG   Myxococcus fulvus: LILAB_12610Help
Entry
LILAB_12610       CDS       T01558                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
mfu  Myxococcus fulvus
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mfu00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    LILAB_12610
Enzymes [BR:mfu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     LILAB_12610
Exosome [BR:mfu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LILAB_12610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2980983..2982473)
Genome map
AA seq 496 aa AA seqDB search
MSKAKYVLALDQGTTGTHVSILDTKLQVVGRSYKEFTQYFPKPSWVEHDLEEIWASSEWC
IARALKNAGLRGGDIAAIGITNQRETTGLWMRGSGQPLSHAIVWQDRRTADQCRRLKEQG
VEPRVREVTGLVVDPYFSGTKLTWMFDHLKGARAKAEKGDVCFGTIDTWLVYKLTGGAAH
VTDVSNASRTLLMDLTTLQWSDEMRALLSVPAACLPQIRGSAEVYGTTRGMRSLPDGIPV
AGMAGDQQSALFGQACFEPGESKCTYGTGAFLLMNTGSEPVRSSAGLLTTVAWRLGGTGT
TTYALEGSSFIAGAAVQWMRDGLKVIKRAPDIEALAASVKDSGDVVFVPALAGLGAPHWR
PEARGLFAGIDRSTTVAHMARAVLEGIALQIHDLAEAMRRDSGRDIPVFKADGGAAANNL
LMQFQADVLGVPLVRPRNLETTSLGAAFLGGLGAGIWDSPDAIRRAWKADKTFKPKMKAD
ARERHLAKWKRAVERA
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaggcgaagtacgtcctggccctggaccagggcaccactggaacgcacgtctcc
atcctcgatacgaagctgcaggtggtgggccgctcctacaaggagttcacccagtacttt
cccaagccctcctgggtggagcacgacctggaggaaatctgggccagcagcgaatggtgt
atcgcccgggcgctgaagaacgccggcctgcgcgggggcgacatcgccgccatcggcatc
accaaccagcgcgagacgacgggcctgtggatgcgcggcagcggccagccgctgtcccac
gccatcgtctggcaggaccgccgcaccgccgaccagtgccgccggctcaaggagcagggc
gtggagccgcgcgtgcgcgaggtgacgggcctggtcgtggacccgtacttctccggcacc
aagctcacgtggatgttcgaccacctgaagggcgcgcgcgcgaaggcggagaagggcgac
gtgtgcttcggcaccatcgacacctggctcgtctacaagctcaccggcggcgcggcgcac
gtcaccgacgtgtccaacgccagccgcacgctgctgatggacctgacgacgctccagtgg
agcgacgagatgcgcgcgctgctgtccgtgccggctgcgtgcctgccgcagattcgcggc
tccgcggaggtgtacggcaccacgcggggcatgcgcagcctgccggacggcatccccgtg
gcgggcatggcgggtgaccagcagtccgccctcttcggccaggcctgcttcgagcccggc
gagtccaagtgcacctacggcaccggcgccttcctgctgatgaacaccggctcggagccg
gtgcgctcgtcggcgggcctgctcaccaccgtggcgtggcggctgggcggcaccggcacc
accacctacgcgctggagggcagcagcttcatcgccggcgcggcggtgcagtggatgcgg
gatggcctcaaggtcatcaagcgcgcgccggacatcgaggcgctggccgccagcgtgaag
gactccggggacgtcgtcttcgtgcccgcgctggccggcctgggcgcgccgcactggcgc
ccggaggcgcgcggcctcttcgccggaatcgaccgctccaccaccgtggcccacatggcg
cgcgcggtgctggagggcatcgcgctgcagattcacgacctggcggaggccatgcgccgc
gacagcgggcgggacatccccgtcttcaaggcggacggcggcgcggcggccaacaacctc
ctgatgcagttccaggcggacgtgctgggcgtgccgctggtgcgcccgcgcaacctggag
accacgagcctgggcgcggccttcctgggcggcctgggcgcgggcatctgggacagcccg
gacgccatccgccgcgcgtggaaggcggacaagacgttcaagccgaagatgaaggcggac
gcccgcgagcggcacctggccaagtggaagcgggccgtggagcgcgcgtga

DBGET integrated database retrieval system