KEGG   Myxococcus fulvus: LILAB_13405Help
Entry
LILAB_13405       CDS       T01558                                 

Definition
glucosyl hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
mfu  Myxococcus fulvus
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:mfu00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:mfu00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3169413..3170522)
Genome map
AA seq 369 aa AA seqDB search
MTTSSTLYRDCARLFMVGFPGTDIDSELAALMDDGIYGAILFKRNVGSAGDTAALCQALK
ARAGRPFILSVDQEGGRVARLRGAPFTTLPPMRELGQRGDVAQVERVGRLLAYELRALGF
DYDFAPVLDVDTNPANPVIGDRSFSREAEEVARLGVALARGLEAGGVASCGKHFPGHGDT
TTDSHLTLPRLPHDLERLRRVELVPFRAFAQAKLASLMTAHVLFDALDPGVPATMSPRVL
QGVLREELGFDGVLVSDDLEMKAIAGHYSVEEATVQGTLAGVDLFLVCHDAEVQRRAIEA
LVKAVESGRVSRERIAQAHRRLDALSARFAHPAEDRLAALGSPEHQALAEGLVSTFTGRD
PTEVMLASR
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
gtgacgacctcctccaccctctaccgcgactgcgcccgcctcttcatggtgggttttccc
ggcaccgacatcgacagcgagctggccgcgctgatggatgacggcatctatggcgccatc
ctcttcaagcgcaacgtgggcagcgctggggacaccgccgccctgtgccaagcgctgaag
gctcgcgcgggtcgccccttcatcctgtcggtggaccaggagggagggcgcgtggcccgg
cttcgcggcgcgcccttcaccacgctgccgcccatgcgggagctgggacaacgcggcgac
gtggcccaggtggagcgggtgggccggctgctggcgtacgagctgcgcgcgctgggcttc
gactatgacttcgcgccggtgctggatgtggacaccaacccggccaaccccgtcattgga
gaccgcagcttcagccgcgaggcggaggaggtggcgcggctgggcgtggcgctcgcgcga
ggcctggaggcgggcggcgtggcgtcgtgtggcaagcacttccccgggcacggcgacacc
accacggacagccacctgacgctgccgcggctgccccatgacctggagcggctgcgccgc
gtggagctggtgcccttccgcgccttcgcccaggcgaagctggcgtccctgatgacggcg
cacgtcctcttcgacgcgctggacccgggcgtgcccgccaccatgagcccgcgcgtgctc
cagggcgtgctgcgcgaggagctgggcttcgacggcgtgctcgtgagcgatgacctggag
atgaaggccatcgccggccactactccgtggaggaggccacggtgcagggcacgctcgcg
ggggtggacctgttcctggtgtgccacgacgcggaggtgcagcgccgcgccatcgaagcg
ctggtgaaggcggtggagtcgggccgcgtctcgcgggagcggattgcccaggcccaccgg
cggctcgacgcgctcagcgcccgcttcgcgcacccggcggaggaccggctcgccgcgctg
gggagtccggagcaccaggcgctggcggaggggctcgtcagcaccttcaccggccgcgac
cccaccgaggtgatgctggcctcccgctga

DBGET integrated database retrieval system