KEGG   Myxococcus fulvus: LILAB_14025Help
Entry
LILAB_14025       CDS       T01558                                 

Definition
(GenBank) phosphomannomutase/phosphoglucomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
mfu  Myxococcus fulvus
Pathway
mfu00010  Glycolysis / Gluconeogenesis
mfu00030  Pentose phosphate pathway
mfu00051  Fructose and mannose metabolism
mfu00052  Galactose metabolism
mfu00230  Purine metabolism
mfu00500  Starch and sucrose metabolism
mfu00520  Amino sugar and nucleotide sugar metabolism
mfu00521  Streptomycin biosynthesis
mfu01100  Metabolic pathways
mfu01110  Biosynthesis of secondary metabolites
mfu01120  Microbial metabolism in diverse environments
mfu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mfu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LILAB_14025
   00030 Pentose phosphate pathway
    LILAB_14025
   00051 Fructose and mannose metabolism
    LILAB_14025
   00052 Galactose metabolism
    LILAB_14025
   00500 Starch and sucrose metabolism
    LILAB_14025
   00520 Amino sugar and nucleotide sugar metabolism
    LILAB_14025
  Nucleotide metabolism
   00230 Purine metabolism
    LILAB_14025
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LILAB_14025
Enzymes [BR:mfu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     LILAB_14025
    5.4.2.8  phosphomannomutase
     LILAB_14025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_III PGM_PMM_II PGM_PMM_IV DUF2218
Motif
Other DBs
NCBI-ProteinID: AEI64710
UniProt: F8CCZ4
Position
3319430..3320800
Genome map
AA seq 456 aa AA seqDB search
MNAHIFREYDIRGLVDKDLTTEVVELLGKGLGTIIRRQGGRSIAVGRDCRESSTRFRDSL
CAGLTSTGLNVFDVGVVPTPLTYFAANTLPVDGLAMITGSHNPPEYNGFKIGAGKTTFHS
HEIQALRKLIEARDFEVSSKPGTVTPYDIITPYNHFVRSTVKVGRKGMRIVIDAGNGTGG
AIAVPLFESMGFDVVPLFCEMDATFPNHHPDPTVVENLEDLIAAVKREKAEVGIAYDGDS
DRIGVIDDQGNILWGDQLMVLFSRYVLKESPGAAIVGEVKCSYTLYDDIAKRGGKPVMWK
AGHSLIKSKMKETQAELAGEMSGHIFFKNRYFGFDDAIYSTARLLEILTQEKATLSELLS
DVPKTYASPELRFDTKEEKKFEMVKRATETLRDAGHDIIDVDGVRVTFPDGWGLIRASNT
QPILVLRFEANTPERLKEIQALIEGTVEKVKVEVGG
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcgcacatcttccgcgaatacgatatccgaggcctggtcgataaggacctcacc
accgaggtggtggagctgctgggcaagggcctgggcaccatcatccgtcgccagggcggg
cgctccatcgcggtgggccgcgactgccgcgagtcctccacccgcttccgggactcgctc
tgcgcgggcctgacgtccaccggcctcaacgtgttcgacgtgggtgtggtccccacgccg
ctgacgtacttcgccgccaacaccctgccggtggacggcctggcgatgattaccggcagc
cacaacccgcccgagtacaacggcttcaagattggcgcggggaagacgaccttccacagc
catgaaatccaggccctgcgcaagctcatcgaggccagggacttcgaggtgtcgtccaag
ccgggcacggtgacgccgtacgacatcatcacgccctacaaccacttcgtgcgcagcacg
gtgaaggtgggccgcaaggggatgcgcatcgtcatcgacgccggcaacggcacgggcggc
gccatcgcggtgccgctcttcgagagcatgggcttcgacgtggtgcccctgttctgtgag
atggacgcgacgttccccaaccaccacccggacccgacggtggtggagaacctggaggac
ctcatcgcggcggtgaagcgcgagaaggccgaggtgggcatcgcctacgacggcgacagc
gaccgcatcggcgtcatcgacgaccagggcaacatcctctggggtgaccagctcatggtg
ctcttcagccgctacgtgctgaaggagagcccgggcgcggccatcgtcggcgaggtgaag
tgcagctacacgctgtacgacgacatcgcgaagcgcggcggcaagcccgtcatgtggaag
gccgggcactcgctcatcaagtcgaagatgaaggagacccaggcggagctggccggcgag
atgagcggccacatcttcttcaagaaccgctacttcggcttcgacgacgccatctactcc
accgcgcgcctgctggagattctcacgcaggagaaggcgaccctgtcggagctgctctcc
gacgtgccgaagacgtacgccagcccggagctgcgcttcgacacgaaggaggagaagaag
ttcgagatggtcaagcgcgccacggagacgctgcgcgacgcgggccacgacatcatcgac
gtggacggcgtgcgcgtgaccttcccagacggctggggcctcatccgcgcctccaacacg
cagcccatcctggtgctgcgcttcgaggccaacacgcccgagcgcctgaaggaaatccag
gccctcatcgagggcacggtggagaaggtcaaggtcgaggtcgggggctga

DBGET integrated database retrieval system