KEGG   Myxococcus fulvus: LILAB_14035Help
Entry
LILAB_14035       CDS       T01558                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
mfu  Myxococcus fulvus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mfu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LILAB_14035
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LILAB_14035
   00052 Galactose metabolism
    LILAB_14035
   00500 Starch and sucrose metabolism
    LILAB_14035
   00520 Amino sugar and nucleotide sugar metabolism
    LILAB_14035
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LILAB_14035
   00524 Butirosin and neomycin biosynthesis
    LILAB_14035
Enzymes [BR:mfu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     LILAB_14035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3321368..3322300
Genome map
AA seq 310 aa AA seqDB search
MPTLGIDLGGTFARAAVVDGVGRLLAAAKVALVERSPSGVVETIAQAASDAVKAAGVPLG
ACGVAAAGQIHKDSGVLSVAPNLGWRNVPLGALLTDRLGHPVRVVNDLAAAAWGELHAGA
GRGAQDMLVVFVGSGVGSAIIAGGHLVDGGGGVAGELGHIKVIPGGRRCGCGELGCLEAY
VGGHNLIAQTRELLASGNSPEVARLTGGDPARITPVTLEQAAEAGDAAAVEVYERAARFL
ALSVANMVTMLNPARLVLGGGVLSHCPGLRRRAEEGVRQWSSMTSREGLLIADAELGDDS
GLIGAALLVK
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgccaacgcttggaatcgacctgggggggaccttcgcccgcgccgcggtggtggacggg
gtgggcaggttgctcgccgccgccaaggtggccctggtggagcgcagcccctcgggggtg
gtggagaccatcgcccaggcggcctcggacgcggtgaaggccgccggggtgcccctgggg
gcctgcggggtggcggccgccgggcagattcacaaggactcgggcgtgctgtcggtcgct
cccaacctgggctggcgcaacgtgccgctgggcgcgctgctcacggaccggctgggccac
ccggtgcgcgtggtgaacgacctggccgcggcggcgtggggagagctgcacgcgggcgcg
ggccggggcgcgcaggacatgctggtggtgttcgtgggctcgggcgtgggcagcgccatc
atcgcgggcggccacctggtggacggcggcggcggcgtggcgggcgagctgggccacatc
aaggtgattccgggtggccgccgctgcggctgcggcgagctggggtgcctggaggcctac
gtgggcggccacaacctcatcgcgcagacgcgcgagctgctggccagcggcaattcgccg
gaggtggcgcggctgacgggcggtgacccggcgcgcatcaccccggtgacgctggagcag
gcggcggaggcgggggacgcggcggcggttgaagtctatgagcgggcggcgcggttcctg
gccctgtccgtggccaacatggtgaccatgctcaacccggcgcggctggtgctgggcggc
ggggtgttgagccactgcccggggttgcggcgccgcgcggaggagggcgtccgccagtgg
tcctcgatgacgtctcgtgaggggttgctcatcgcggacgcggagctgggagatgacagc
ggtctgattggcgcggcgttgctggtgaagtag

DBGET integrated database retrieval system