KEGG   Myxococcus fulvus: LILAB_14345Help
Entry
LILAB_14345       CDS       T01558                                 

Definition
malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
mfu  Myxococcus fulvus
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mfu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LILAB_14345
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    LILAB_14345
   00630 Glyoxylate and dicarboxylate metabolism
    LILAB_14345
Enzymes [BR:mfu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     LILAB_14345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3397837..3399462)
Genome map
AA seq 541 aa AA seqDB search
MSDQAPAVKPPAFGPGVVVKGTWHPDYAEVLTPEALEFVAKLARNFGERRLALLERRKAV
QAAWRQGERPHFLPETKAIREGDWTVAPLPADLQDRRVEITGPVDRKMVINALNSGANVF
MADFEDANSPTWDNVVRGQVNLRDAVRGTISFTAENGKHYALNPKRAVLFVRPRGWHLPE
RHIEIDGKPISGSLLDFGLFFFHNAREQLARGTGPYFYLPKLQSHLEARLWNDVFHLAQA
ELDIPRGTIKATVLIETLPAAFEMDEILYELREHSAGLNCGRWDYIFSFIKTLQSDTRVV
LPDRGQVTMDKAFLNAYSQLLIQTCHRRNVHAMGGMAAFIPIKGDAAANDAVMDKVRADK
LREVKNGHDGTWVAHPGLVEIARDIFDSHMKGPNQLSNKREDVKIGEAELLKVPSGTRTE
EGLRHNIRVGIQYTAAWLGGLGCVPLYNLMEDAATAEISRAQVWQWLHHGATLEDGRAVT
PALFRDVLGEEMGRLEKEGAKERYGAAHLERARVLFEQLSTADTFEDFLTLPAYDALEAQ
R
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaccaagcccccgctgtgaagcccccggcgttcggaccgggcgtggtggtgaag
gggacctggcaccccgactacgccgaggtcctcacccccgaggccctggagttcgtggcg
aagctggcgcgcaacttcggggagcgccggctggcgctgctggagcgccgcaaggcggtg
caggcggcctggcgccagggcgagcgcccccacttcctgccggagacgaaggccatccgg
gagggcgactggacggtggcgcccctgcccgccgacctccaggaccgccgcgtggaaatc
accggcccggtggaccggaagatggtcatcaacgcgctgaactccggcgccaacgtcttc
atggcggacttcgaggacgccaacagccccacctgggacaacgtggtgcgcgggcaagtc
aacctgcgcgacgcggtgcgcggcaccatctccttcaccgcggagaacgggaagcactac
gccctcaacccgaagcgcgccgtgctcttcgtgcggccccgcggctggcacctgccggag
cggcacatcgaaatcgacggcaagcccatctccggctcgctgctcgacttcgggctcttc
ttcttccacaacgcccgtgagcagctcgcgcgcggcaccggcccctacttctacctgccg
aagctgcagagccacctggaggcccggctgtggaacgacgtgttccacctggcccaggcg
gagctggacatcccgcgcggcaccatcaaggccaccgtcctcatcgagacgctgcccgcc
gcgttcgagatggacgaaatcctctacgagctgcgcgagcactccgccggcctcaactgc
ggccgctgggactacatcttcagcttcatcaagacgctccagtccgacacccgcgtggtg
ctgcccgaccgcggacaggtgacgatggacaaggcgttcctcaacgcctactcgcagctc
ctcatccagacctgccaccgccgcaacgtgcacgccatgggcggcatggcggccttcatc
cccatcaagggtgacgcggcggccaacgacgccgtcatggacaaggtccgcgcggacaag
ctgcgcgaggtcaagaatggccatgacgggacgtgggtggcccaccccggcctcgtggaa
atcgcgcgcgacatcttcgactcgcacatgaagggccccaaccagctctccaacaagcgc
gaggacgtgaagattggcgaggcggagctgctcaaggtgccgtccggcacgcgcaccgag
gagggcctgcgccacaacatccgcgtgggcatccagtacaccgccgcgtggctgggcggc
ctgggctgcgtgcccctctacaacctgatggaggacgcggccaccgccgaaatctcccgc
gcccaggtgtggcagtggctccaccacggcgccacgctggaggacggccgcgcggtgacg
cccgccctcttccgcgacgtgctgggcgaggagatgggccggctcgagaaggagggcgcg
aaggagcgctacggcgccgcccacctggagcgcgcccgcgtcctcttcgagcagctctcc
accgccgacaccttcgaggacttcctcaccctgccggcctacgacgccctggaagcccag
cgctga

DBGET integrated database retrieval system