KEGG   Myxococcus fulvus: LILAB_14345Help
Entry
LILAB_14345       CDS       T01558                                 

Definition
(RefSeq) malate synthase
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
mfu  Myxococcus fulvus
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mfu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LILAB_14345
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    LILAB_14345
   00630 Glyoxylate and dicarboxylate metabolism
    LILAB_14345
Enzymes [BR:mfu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     LILAB_14345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3397837..3399462)
Genome map
AA seq 541 aa AA seqDB search
MSDQAPAVKPPAFGPGVVVKGTWHPDYAEVLTPEALEFVAKLARNFGERRLALLERRKAV
QAAWRQGERPHFLPETKAIREGDWTVAPLPADLQDRRVEITGPVDRKMVINALNSGANVF
MADFEDANSPTWDNVVRGQVNLRDAVRGTISFTAENGKHYALNPKRAVLFVRPRGWHLPE
RHIEIDGKPISGSLLDFGLFFFHNAREQLARGTGPYFYLPKLQSHLEARLWNDVFHLAQA
ELDIPRGTIKATVLIETLPAAFEMDEILYELREHSAGLNCGRWDYIFSFIKTLQSDTRVV
LPDRGQVTMDKAFLNAYSQLLIQTCHRRNVHAMGGMAAFIPIKGDAAANDAVMDKVRADK
LREVKNGHDGTWVAHPGLVEIARDIFDSHMKGPNQLSNKREDVKIGEAELLKVPSGTRTE
EGLRHNIRVGIQYTAAWLGGLGCVPLYNLMEDAATAEISRAQVWQWLHHGATLEDGRAVT
PALFRDVLGEEMGRLEKEGAKERYGAAHLERARVLFEQLSTADTFEDFLTLPAYDALEAQ
R
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaccaagcccccgctgtgaagcccccggcgttcggaccgggcgtggtggtgaag
gggacctggcaccccgactacgccgaggtcctcacccccgaggccctggagttcgtggcg
aagctggcgcgcaacttcggggagcgccggctggcgctgctggagcgccgcaaggcggtg
caggcggcctggcgccagggcgagcgcccccacttcctgccggagacgaaggccatccgg
gagggcgactggacggtggcgcccctgcccgccgacctccaggaccgccgcgtggaaatc
accggcccggtggaccggaagatggtcatcaacgcgctgaactccggcgccaacgtcttc
atggcggacttcgaggacgccaacagccccacctgggacaacgtggtgcgcgggcaagtc
aacctgcgcgacgcggtgcgcggcaccatctccttcaccgcggagaacgggaagcactac
gccctcaacccgaagcgcgccgtgctcttcgtgcggccccgcggctggcacctgccggag
cggcacatcgaaatcgacggcaagcccatctccggctcgctgctcgacttcgggctcttc
ttcttccacaacgcccgtgagcagctcgcgcgcggcaccggcccctacttctacctgccg
aagctgcagagccacctggaggcccggctgtggaacgacgtgttccacctggcccaggcg
gagctggacatcccgcgcggcaccatcaaggccaccgtcctcatcgagacgctgcccgcc
gcgttcgagatggacgaaatcctctacgagctgcgcgagcactccgccggcctcaactgc
ggccgctgggactacatcttcagcttcatcaagacgctccagtccgacacccgcgtggtg
ctgcccgaccgcggacaggtgacgatggacaaggcgttcctcaacgcctactcgcagctc
ctcatccagacctgccaccgccgcaacgtgcacgccatgggcggcatggcggccttcatc
cccatcaagggtgacgcggcggccaacgacgccgtcatggacaaggtccgcgcggacaag
ctgcgcgaggtcaagaatggccatgacgggacgtgggtggcccaccccggcctcgtggaa
atcgcgcgcgacatcttcgactcgcacatgaagggccccaaccagctctccaacaagcgc
gaggacgtgaagattggcgaggcggagctgctcaaggtgccgtccggcacgcgcaccgag
gagggcctgcgccacaacatccgcgtgggcatccagtacaccgccgcgtggctgggcggc
ctgggctgcgtgcccctctacaacctgatggaggacgcggccaccgccgaaatctcccgc
gcccaggtgtggcagtggctccaccacggcgccacgctggaggacggccgcgcggtgacg
cccgccctcttccgcgacgtgctgggcgaggagatgggccggctcgagaaggagggcgcg
aaggagcgctacggcgccgcccacctggagcgcgcccgcgtcctcttcgagcagctctcc
accgccgacaccttcgaggacttcctcaccctgccggcctacgacgccctggaagcccag
cgctga

DBGET integrated database retrieval system