KEGG   Myxococcus fulvus: LILAB_14605Help
Entry
LILAB_14605       CDS       T01558                                 

Definition
(GenBank) 6-phosphofructokinase I
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
mfu  Myxococcus fulvus
Pathway
mfu00010  Glycolysis / Gluconeogenesis
mfu00030  Pentose phosphate pathway
mfu00051  Fructose and mannose metabolism
mfu00052  Galactose metabolism
mfu00680  Methane metabolism
mfu01100  Metabolic pathways
mfu01110  Biosynthesis of secondary metabolites
mfu01120  Microbial metabolism in diverse environments
mfu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mfu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LILAB_14605
   00030 Pentose phosphate pathway
    LILAB_14605
   00051 Fructose and mannose metabolism
    LILAB_14605
   00052 Galactose metabolism
    LILAB_14605
  Energy metabolism
   00680 Methane metabolism
    LILAB_14605
Enzymes [BR:mfu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     LILAB_14605
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     LILAB_14605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK HHH_6 UPF0261 NAD_kinase
Motif
Other DBs
NCBI-ProteinID: AEI64826
UniProt: F8CEF6
Position
complement(3470647..3471672)
Genome map
AA seq 341 aa AA seqDB search
MLTGGGDCPGLNAVIRAVVRRANAHGFEMMGLRDGWKGLLEDNHFRLTRETTSGILHRGG
TILGTSRVNPFKVENGLERVKRAIERNGIHAVIAIGGEGTLSAATRMSQEGLRIVGVPKT
IDNDINATDFTFGFDTAVAIATEAIDRLHSTAESHKRVIVCEVMGRHVGWIATYAGIAGG
ADVILVPEIPADLEKVAEHIQRRHAGGRTFSIVVVAEGTRIKLSADQQEQLVTSGALDEA
GRPRLGGVGTILAHEIERRTGFETRVSVLGHIQRGGAPTPHDRVLATRYGVHACDMVARG
EFGKMAALRGNDIISVDLADATRELKRVPQEFFEVAQVFFG
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
gtgctcaccggcgggggcgactgccccggcctgaacgccgtcatccgcgccgtcgtccgc
cgcgccaacgcccacggcttcgagatgatgggcctccgggatggttggaaggggttgctg
gaggacaaccacttccgcctcacgcgtgaaaccacgtccggcatcctccaccggggcggc
accatcctcggcacctcgcgcgtcaacccgttcaaggtcgaaaacgggctggagcgcgtc
aagcgcgccatcgaacgcaacggcatccacgccgtcatcgccattggcggcgagggcacg
ctgtcggccgccacgcgcatgtcgcaggaagggctgcgcatcgtcggggtgccgaagacc
atcgacaacgacatcaacgccacggacttcaccttcggcttcgacacggccgtcgccatc
gccaccgaggccattgaccggctgcactccaccgcggagtcgcacaagcgcgtcatcgtc
tgcgaggtgatgggccggcacgtgggctggattgccacctacgcgggcatcgccggcggc
gcggacgtcatcctcgtcccggagattcccgcggacctggagaaggtggccgagcacatc
cagcgccgccacgcgggcgggcgcaccttctccatcgtcgtggtggcggagggcacgcgc
atcaagctgtccgcggaccagcaggagcagctcgtcaccagcggcgcgctggacgaggcg
ggcaggccgcggctcggcggcgtgggcaccatcctggcgcacgaaatcgagcggcgcact
ggcttcgagacgcgcgtctccgtgctgggccacatccagcgcggcggcgcgcccacgccg
cacgaccgcgtgctggccacccgctacggcgtccacgcctgcgacatggtggcccgcggc
gagttcgggaagatggccgcgctgcgaggcaacgacatcatcagcgtggacctggccgac
gccacccgcgagctgaagcgcgtcccgcaggagttcttcgaggtcgcccaggtcttcttc
ggctga

DBGET integrated database retrieval system