KEGG   Myxococcus fulvus: LILAB_14925Help
Entry
LILAB_14925       CDS       T01558                                 

Definition
fatty acid desaturase family protein
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
mfu  Myxococcus fulvus
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:mfu01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:mfu01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3539065..3540129)
Genome map
AA seq 354 aa AA seqDB search
MQTPSQALPAADERLNWRSSIPFFAVHLMCLFVFAVGAKPVDVAVCVGLYVVRMWGITAG
FHRYFSHRAFKTGRVFQFILAFVGSMSAQKGVLWWAAHHRHHHRHSDQAEDIHSPLQKGF
WWSHVGWILSDKYNDTRLEGIKDFARFPELVWLNRFHLVPPVLLGVALYFIGGFSMLVWG
FFVSTTLLWHGTFTINSLSHIFGKRRYKTTDTSRNNWLLALVTLGEGWHNNHHFHQNTAN
QGWFWWEVDLSYYSLRVLSWFKVVEGLRLPSEATKYAFQKYTEEERAALAAPTRFWGASG
ERAQLVAAKAASDAAKVASDAAKAAGDKVREALTAAADHLPTSAPPPSALLKRR
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
ttgcagacaccgtcccaagccctgcccgcggcggatgagcgcctcaactggcgctcctcc
atccccttcttcgccgtccacctgatgtgcctcttcgtcttcgccgtcggggcgaagccg
gtggacgtggccgtctgcgtcggcctctacgtcgtgcgcatgtggggcatcaccgcgggc
ttccaccggtacttctcccaccgggccttcaagacggggcgcgtcttccagttcatcctg
gccttcgtgggcagcatgtccgcgcagaagggcgtgctgtggtgggccgcgcaccaccgc
caccaccaccgccattcggaccaggcggaggacatccactcgcccctgcagaagggcttc
tggtggagccacgtggggtggattctctccgacaagtacaacgacacccgcctggagggc
atcaaggacttcgcccgcttcccggagctggtgtggctcaaccgcttccacctggtgccg
cccgtcctgctgggcgtggccctctacttcatcggcggcttctccatgctggtgtggggc
ttcttcgtcagcaccaccctgctgtggcacggcaccttcaccatcaattcgctcagccac
atcttcggcaagcgccgctacaagacgacggacaccagccgcaacaactggctgctggcg
ctcgtgacgctgggcgaggggtggcacaacaaccaccacttccaccagaacaccgccaac
cagggctggttctggtgggaggtggacctcagctactactcgctgagggtgctctcctgg
ttcaaggtggtggagggcctgcggctgccctccgaggccacgaagtacgccttccagaag
tacaccgaggaggagcgcgcggcgctggcggcgcccacccgcttctggggcgcctcgggc
gagcgggcccagctcgtggcggcgaaggccgccagcgacgccgcgaaggtcgccagtgac
gccgcgaaggccgcgggtgacaaggtgcgcgaggccctgacggccgccgcggaccacctg
cccacctccgcgccgccgccgtccgccctgctcaagcggcgatag

DBGET integrated database retrieval system