KEGG   Myxococcus fulvus: LILAB_15940Help
Entry
LILAB_15940       CDS       T01558                                 

Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mfu  Myxococcus fulvus
Pathway
mfu00260  Glycine, serine and threonine metabolism
mfu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mfu01100  Metabolic pathways
mfu01110  Biosynthesis of secondary metabolites
mfu01130  Biosynthesis of antibiotics
mfu01230  Biosynthesis of amino acids
Module
mfu_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mfu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LILAB_15940
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LILAB_15940
Enzymes [BR:mfu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LILAB_15940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA BtpA NMO IGPS His_biosynth PcrB NanE ThiG Adeno_VII FIST TMP-TENI
Motif
Other DBs
NCBI-ProteinID: AEI65091
UniProt: F8CJR4
Position
complement(3773075..3773866)
Genome map
AA seq 263 aa AA seqDB search
MSGEIAQAFARAKERGEGVLVAYAMAGDPDLPRSVDVFAALVEGGADILELGVAFSDPIA
DGPVIQGAAERALKAGSTLKRVLDEVVPAVRQRCPQTPLVIMTYVNVIMAMGEARYAKLA
RERGVSGTILPDLPPEESAALRATFDAEGMDLIPLCAPTTPPARAQAIAKDGRGFVYCVS
VSGVTGMRAELPPDLSQRLDLVRKAASVPIVAGFGISTEEQARTLSAHADGVVVGSALVR
AAHTAGPAAAKALCADIKRGLRR
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
gtgagcggcgagattgcgcaggccttcgcccgggcgaaggagcgtggtgagggcgtgctg
gtggcctacgccatggcgggcgacccggacctgcctcgctcggtggacgtgttcgccgcg
ctggtggagggcggcgcggacatcctggagctgggcgtggcgttcagcgaccccatcgcg
gacggccctgtcatccagggcgcggcggagcgggcgctcaaggccggctccacgctgaag
cgcgtgctggacgaagtggttccggcggtgcgccagcgctgcccccagacgccgctggtc
atcatgacgtacgtcaacgtcatcatggccatgggcgaggcgcgctacgcgaagctcgcg
cgggagcggggcgtgtcagggaccatcctccccgacttgccgcccgaggagagcgcggcc
ctgcgcgccaccttcgacgcggaggggatggacttgattccgctgtgcgcgcccaccacg
cccccggcgcgggcgcaggccatcgcgaaggacggacggggcttcgtctattgcgtctcc
gtgtcgggcgtgacgggcatgcgcgcggagctgcctcccgacctgtcacagcggctggac
ctggtgcgcaaggccgcgtccgtgcccatcgtcgcgggctttggcatctccaccgaggag
caggcgcgaacgctgtctgcccatgcggacggtgtcgtcgtgggcagcgcgttggtgcgc
gccgcgcacacagcaggccccgcggcggcgaaggcgctgtgtgccgacatcaagcgcggg
ctgcggcgttga

DBGET integrated database retrieval system