KEGG   Myxococcus fulvus: LILAB_15945Help
Entry
LILAB_15945       CDS       T01558                                 

Definition
(GenBank) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mfu  Myxococcus fulvus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mfu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LILAB_15945
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LILAB_15945
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LILAB_15945
Enzymes [BR:mfu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LILAB_15945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3773863..3775068)
Genome map
AA seq 401 aa AA seqDB search
MSTETATGRFGRYGGRYVPETLVPALLELEEAYAAASADPAFGEEVARVLREFVGRPTTL
TPARRLTEAWGGANVWLKREDLAHTGAHKINNTVGQVLLAKRMGKKRIIAETGAGQHGVA
TATACALFGLPCEVYMGALDVERQALNVFRMRALGAVVRPVESGSRTLKDAMNEAMRTWV
SQVSDTHYVIGSAAGPHPYPTVVRDFQAVIGRELRTQAQAAWGGLPDAIIACVGGGSNAI
GVLHPFIGDASVRLVGVEAGGHGLASKQHGASLTLGTEGVLHGSRSLVLQDEDGQIQEAH
SISAGLDYPGVGPELAHLAKTGRMEVRTATDDEALAAFYEVARLEGILPALETSHAFARG
RELARELGAGRHLVINCSGRGDKDVATISARGVPPPVGVKA
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgagtacggagactgccaccggccgcttcgggcgctacggcggacgctacgtgccggag
acgctggtcccggcgctgctggagctggaggaggcgtatgccgccgccagcgcggacccg
gccttcggtgaggaggtcgcccgggtgctgcgcgagttcgtgggccggcccacgacgctg
acgcccgcccgtcgcctcacggaggcctggggcggcgcgaatgtgtggctcaagcgcgag
gacctggcgcacaccggcgcgcacaaaatcaacaacaccgtggggcaggtgctgctcgcg
aagcggatgggcaagaagcgcatcatcgcggagacgggcgcgggccagcacggcgtggcc
accgccaccgcgtgcgccctcttcggcctgccctgcgaggtgtacatgggcgcgctggac
gtggagcggcaggcgctcaacgtcttccgcatgcgcgcgctgggcgcggtggtgcggccg
gtggagtccggctcgcgcacgctgaaggacgcgatgaacgaggccatgcgcacctgggtg
tcgcaggtgtcggacacgcactacgtcatcggcagcgcggcggggccgcacccgtacccc
acggtggtgcgcgacttccaggccgtcatcggccgcgagctgcgcacgcaggcccaggcg
gcctggggtgggctgccggacgccatcatcgcgtgcgtgggcggcggctcgaacgccatt
ggcgtgctgcacccgttcatcggtgacgccagcgtgcggctggtgggcgtggaggccggt
ggccacggcctggcttcgaagcagcacggcgcgtcgctgacgctggggacggagggcgtg
ctgcacggctcgcgctcgctggtgctccaggacgaggacggccagattcaggaggcgcac
agcatctccgccggcctggactacccgggcgtggggccagagctggcgcacctggcgaag
acgggccgcatggaggtccgcaccgccaccgacgacgaggcgctggcggccttctacgag
gtggcgcgcctggagggcatcctccccgcgctggagacgtcccacgccttcgcgcgcggc
cgggagctggcgcgcgagctgggcgcgggcaggcacctggtcatcaactgctcgggccgc
ggcgacaaggacgtggccacgatctccgcgcggggcgtgcctccgccggtgggggtgaag
gcgtga

DBGET integrated database retrieval system