KEGG   Myxococcus fulvus: LILAB_15955Help
Entry
LILAB_15955       CDS       T01558                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mfu  Myxococcus fulvus
Pathway
mfu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mfu01100  Metabolic pathways
mfu01110  Biosynthesis of secondary metabolites
mfu01130  Biosynthesis of antibiotics
mfu01230  Biosynthesis of amino acids
Module
mfu_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mfu00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LILAB_15955
Enzymes [BR:mfu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     LILAB_15955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE His_biosynth FMN_dh
Motif
Other DBs
NCBI-ProteinID: AEI65094
UniProt: F8CJR7
Position
complement(3775709..3776515)
Genome map
AA seq 268 aa AA seqDB search
MTLPSNGPAPGTLDRIMARKRQELAARPPMAPRVRPVHRDFAQGLVTHRSGRRVSVIAEV
KRKSPSGGAFPHADVVAVARAYEAAGASAISVLTDGPDFGGALEDLVAVRAAVALPVLRK
DFLVAAREVEESALWGADAVLLIADALEDGELREMVATAKAVGVAALVEAHTEAHAERAL
AAGAKLVGINNRDLATLKTDTGTALRVMPKLRTRARVLVAESGLKTPADLLAAQDAGADA
VLVGESLLREPDPGHALRRLLGLEDAAP
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgaccctcccttcgaacggccccgcgccgggaacgctggaccgcatcatggcgcgcaaa
cgccaggagctcgcggcgcgtccgcccatggcgcctcgcgtgcgccccgtccaccgcgac
ttcgcccagggcctggtgacccaccgctccgggcggcgcgtgagcgtcatcgcggaggtg
aagcgcaagagcccgtcagggggcgcgttcccccacgccgacgtggtggcggtggcccgg
gcctatgaggccgcgggcgccagcgccatcagcgtgctgacggatgggccggacttcggc
ggcgcgctggaggacctcgtggcggtgcgggcggcggtggcgctgcccgtgctgcgcaag
gacttcctcgtcgccgcgcgtgaagtggaggagagcgcgctgtggggcgccgacgcggtg
ctgctcatcgccgacgcgctggaggacggcgagctgcgggagatggtcgccacggcgaag
gcggtgggcgtggccgcgttggtggaggcccacacggaggcgcacgccgagcgcgcgctg
gccgcgggcgcgaagctggtgggcatcaacaaccgcgacctcgccacgctgaagacggac
acggggacggcgctgcgggtgatgccgaagctccgcacccgggcccgggtgctggtggcg
gagagcggcctgaaaacccccgcggacctgctggcggcccaggacgcgggcgcggacgcg
gtcctggtgggcgagtcgctgctccgcgagcccgaccctggacacgcgctgcggcggctg
ctcgggctggaggacgcggccccatga

DBGET integrated database retrieval system