KEGG   Myxococcus fulvus: LILAB_16110Help
Entry
LILAB_16110       CDS       T01558                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mfu  Myxococcus fulvus
Pathway
mfu00020  Citrate cycle (TCA cycle)
mfu00310  Lysine degradation
mfu01100  Metabolic pathways
mfu01110  Biosynthesis of secondary metabolites
mfu01120  Microbial metabolism in diverse environments
mfu01130  Biosynthesis of antibiotics
mfu01200  Carbon metabolism
Module
mfu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mfu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mfu00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LILAB_16110
  Amino acid metabolism
   00310 Lysine degradation
    LILAB_16110
Enzymes [BR:mfu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     LILAB_16110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding
Motif
Other DBs
NCBI-ProteinID: AEI65125
UniProt: F8CJU8
Position
complement(3814081..3814908)
Genome map
AA seq 275 aa AA seqDB search
MDISQVKGSGAGGRVHKDDVLGQLNRPAAPAAPAQPAGPRPNAAREERVRMTPLRKRVAE
RLIQAQSTAAMLTTFNEVDMGEVMALRKKYNEKFQQKHGVKLGFMSFFIRASVEALKAFP
QINAEIDGEDVIFKHYYDIGVAVSGSRGLVVPVVRNADKQGLAELEKSVGELGSKARNDK
LALSDLQGGTFTITNGGIFGSMLSTPILNPPQTGILGMHNIVERPVARDGQVVIRPIMYI
ALTYDHRLVDGREAVQFLVRVKECIEDPERLLLDV
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
gtggacatctcccaggtgaagggcagcggcgccggtggccgcgtgcacaaggacgacgtg
ctgggtcagctcaaccgcccggccgcgcccgccgccccggcccagcccgccggcccccgt
ccgaacgccgcccgcgaggagcgcgtgcggatgacgccgctgcgcaagcgcgtggccgag
cgcctcatccaggcccagtccaccgccgccatgctcaccaccttcaacgaggtggacatg
ggcgaggtgatggccctgcgcaagaagtacaacgagaagttccagcagaagcacggcgtg
aagctcggcttcatgagcttcttcatccgcgcctccgtcgaggccctcaaggccttcccg
cagatcaacgcggagattgacggcgaggacgtcatcttcaagcactactacgacatcggc
gtggccgtgagcggcagccgcggtctggtggtgccggtggtgcgcaacgcggacaagcag
ggcctggcggagctggagaagtccgtgggcgagctgggcagcaaggcgcgcaacgacaag
ctggccctgtccgacctgcagggtggcaccttcaccatcaccaacggcggcatcttcggc
tccatgctgtccacgcccatcctgaacccgccgcagacgggcatcctgggcatgcacaac
atcgtcgagcgccccgtggcccgcgacggccaggtcgtcatccggcccatcatgtacatc
gccctcacctacgaccaccgcctggtggacggccgcgaggccgtgcagttcctggtgcgc
gtgaaggagtgcatcgaggacccggagcgcctgctcctggacgtctga

DBGET integrated database retrieval system