KEGG   Myxococcus fulvus: LILAB_16160Help
Entry
LILAB_16160       CDS       T01558                                 

Definition
putative protein-glutamate methylesterase CheB
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
mfu  Myxococcus fulvus
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:mfu02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:mfu02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3824917..3825984
Genome map
AA seq 355 aa AA seqDB search
MSIKRPIRVLVVDDSPTMANMLTALLTEEPRIEVVGRAGDGNRAVQLARLLRPDVITMDL
LLPGLDGPGAIAAIMAQSPARILVVSAVAEQRGVDLGFQAMSAGALELIGKPNVTNAEEL
RRWGKELAHSVCLMAEVPVISRRARATAAPPPPTGARVDIFGVVASTGGPPALAEVLSRL
PRSLPVPLLVAQHITVGFTQGMVRWLSQVTPLPVSIAKDGERLEPGHVYFPLDGNDLLVD
AAGLARLQPSRGGPCPSGDVMLASLAAAFGRRSGGVVLTGMGEDGARGLLAIRKAGGVTY
SQDEASSVVFGMPRAAIEVKATDQGVPLSSLPELILQSCTFAPFRSGRPDGGPAR
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
gtgagcatcaagcggcccatccgggtcctcgtggtggacgactcgcccaccatggccaac
atgctgacggccctcctcacggaggagccgcgcatcgaggtcgtgggccgggcgggtgac
ggcaaccgcgccgtgcagctcgcgcgcctcctgcgtcccgacgtcatcaccatggacctg
ctgctgcccgggctggatgggccgggggccatcgcggccatcatggcccagtcccccgcg
cgcatcctcgtggtgagcgcggtggcggagcagcgcggcgtggacctgggcttccaggcg
atgagcgccggcgcgctggagctcatcggcaagcccaacgtgacgaacgcggaggagctg
cgccgctggggcaaggagctggcgcactcggtgtgcctcatggcggaggtgccggtcatc
tcccgccgggcgcgcgccaccgcggcccctccgccgcccaccggcgcgcgggtggacatc
ttcggtgtggtggcctccacgggcgggccgcccgcgctggcggaggtgctgtccaggctg
ccccgctcgctgccggtgccgctgctcgtggcccagcacatcaccgtgggcttcacccag
ggcatggtgcgctggctgtcccaggtgacgccgctgccggtgtccatcgccaaggacggc
gagcggctggagccgggccacgtgtacttcccgctggacgggaacgacctgctggtggac
gcggccgggctggcgcggctgcagcccagccggggcgggccgtgccccagcggagacgtg
atgctggcgtcgctggccgccgccttcggccggcgcagcggcggcgtggtcctcaccggc
atgggcgaggacggcgcgcggggcctgctcgccatccgcaaggcgggcggcgtcacctac
tcccaggacgaggcgtcctcggtcgtcttcggcatgccgcgcgccgccattgaagtgaag
gccaccgaccagggggtgcccctgtcctcgctgccggagctcatcctgcagagctgtacc
ttcgcccccttccgaagcgggcgcccggatggaggtcccgcccggtga

DBGET integrated database retrieval system