KEGG   Myxococcus fulvus: LILAB_16510Help
Entry
LILAB_16510       CDS       T01558                                 

Definition
D-ala D-ala ligase domain-containing protein
Orthology
K01921  
D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
mfu  Myxococcus fulvus
Pathway
D-Alanine metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of other amino acids; D-Alanine metabolism [PATH:mfu00473]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:mfu00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3899918..3900997)
Genome map
AA seq 359 aa AA seqDB search
MHIILLHNRDHDLLEDDPGREAREDVVRVVSSLADALNQGDTLAEPLAIEGDRLDFVDTL
RRRQPDLVVNLCESLAADSRGEMAVPCLLDALGLAYTGSSALSLGLALHKPKAKEVLTAR
GVSTPPFRVVERLEDALAVDLPWPLIVKPAREDASMGVTSESVVHERAALVRACDAVLRE
FHQPALVEQFIPGREIYVPLLGNQPRQALPLTEIVFGRTFEDRPNIVSYNAKWEAASAEY
RDTTSGLCRLDANLESRCVQVALEAFAALDCQDYGRVDLRVSPEGVPYVIDINPNCDLHP
SAGFAKAALAAGMDYPALASRLVEVALERAHGHPSHRRKGPGADRRADSKDRNLLAAGG
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgcacatcatcctgctgcacaaccgcgaccacgacctcctcgaggacgaccctgggcgg
gaggcccgggaggatgtggtccgcgtcgtctcctcgctggcggacgccctcaaccagggc
gacaccctggccgagccgctcgccatcgaaggggaccggctcgacttcgtggacacgctg
cgccggcgccagccggacctggtcgtcaacctctgcgagtccctggcggccgacagccgc
ggggagatggcggtgccctgcctgctggacgcgctggggctggcctacacgggctcgtcc
gcgctgtccctgggcctggccctgcacaagcccaaggcgaaggaggtcctcaccgcgcgc
ggcgtgtccaccccgcccttccgcgtggtggagcgcctggaggatgcgctggcggtggac
ctgccctggcccctcatcgtcaagcccgcgcgcgaggacgccagcatgggcgtgacgtcg
gagtccgtggtgcacgagcgcgccgccctggtccgcgcctgtgacgcggtgctccgcgag
ttccatcagcccgccctggtggagcagttcatccccgggcgtgaaatctatgtgccgctg
ctcggcaaccagccgcgccaggcactgcccctgacggaaatcgtcttcggccgtacgttc
gaggacagacccaacatcgtctcctacaacgcgaagtgggaggcggcgtcggcggagtac
cgggacaccaccagcggattgtgccggctggacgcgaacctggagtcccgttgcgtgcag
gttgcgctggaagcctttgcagcactggactgtcaggactatggacgggtcgacctccgg
gtgtctccggagggcgtgccctacgtcatcgacatcaaccccaactgtgacctccacccg
agcgcggggttcgccaaggccgccctggccgccggcatggactacccggccctggcgtcc
cggctcgtggaggtcgcgctcgagagagcacatggacatccgtcccatcgaagaaaagga
ccgggcgccgatcgccgcgctgattcgaaagatcgaaaccttctcgccgcaggaggttga

DBGET integrated database retrieval system